KEGG   Drosophila arizonae: 108619880Help
Entry
108619880         CDS       T05886                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SMYD3
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
daz  Drosophila arizonae
Pathway
daz00310  Lysine degradation
daz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:daz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108619880
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:daz03036]
    108619880
Enzymes [BR:daz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     108619880
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     108619880
Chromosome and associated proteins [BR:daz03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108619880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-MYND TPR_12 TPR_2
Motif
Other DBs
NCBI-GeneID: 108619880
NCBI-ProteinID: XP_017872174
LinkDB All DBs
Position
X
AA seq 448 aa AA seqDB search
MESSSKLAIKRGTRILTEKPFAYVLKSKYRLERCDNCLEATKVLKCSNCRYVSYCNRSCQ
QQAWSIHKHECLFLKRALPRIVPDAARMLCRLILRLEHGGDLERGYYTEHGSRKFRDLMS
HYAEIKNDPKRIEHLESLHAVLTDMMAESGKGSLTGSLVPNMNELMSIYGRLITNGFNIL
DAEMNSIATGIYLGVSITDHSCQPNAVATFEGNELHVHAIEDLPCLDWSKIYISYIDLLN
TPEQRRADLKEHYYFLCVCSKCIDPQEMHEMTAAVCPNGSCDASVNIQLDKCESCGTPVS
EQLRTDYSEVMALTQSSLDSMKEVAYLDVCKVCLAKHRGILHPLNVWHVKTLDAAFEASI
QVGKWTEALDYGRQLLPGFAKYHGEWNPLLGLLQLKLGKIELYERNYKQALQHLQEAQRI
LNVTHGQDHRLLLEQLRPLMLQAKHEMR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggagtcctcgtcgaaactggccataaaacgcggcacgcgaattctgactgagaagcca
tttgcgtacgtgctcaagtcgaaatatcgactggaacgctgcgataattgcctggaagcg
acaaaagtgctgaagtgctccaactgccgttatgtctcctactgcaatcgcagctgccag
caacaggcttggtccatccacaagcacgagtgcctgttcctcaagcgtgcgctgccgcgc
attgtgcccgacgcggcgaggatgctctgccggcttatattgcggctggagcacggcggc
gatctggaaagaggctactacacggagcacggatcgcgcaaattccgcgatctaatgtca
cactatgcggagattaagaacgacccgaagcgcattgagcatttggaatcgttgcatgct
gtgctcacggatatgatggcggagagcggaaaaggaagtctaactggaagtctggtgccc
aacatgaatgaactgatgagtatttatggtcgtctcatcacgaacggcttcaacatcctg
gatgcagagatgaattcgatagcgactggcatttatctgggcgtctccataacagatcac
agctgccagccgaatgcggtggccacgttcgagggcaacgagctgcacgtgcacgccatt
gaggacctgccgtgcctggattggtccaagatctacataagctacatcgatctgctcaac
acgcccgagcagcggcgggcagatctaaaggagcattactatttcctctgcgtgtgcagc
aagtgcatcgatccgcaggagatgcacgaaatgaccgcagccgtttgtccgaatggcagc
tgcgacgctagcgtcaatatacaattggataaatgtgagagctgcggaacgcccgtgtcg
gagcagctgcgcaccgactacagcgaggtgatggcgctgacgcagtccagcttggactcc
atgaaggaggtggcctatctggacgtctgcaaggtatgcctggccaagcatcgtggcatc
ctgcatcccttaaacgtttggcacgtgaagacactcgatgctgccttcgaggcatcgatc
caggtgggcaagtggacagaggcattggactatggaaggcagctgctgccaggctttgct
aaataccacggggaatggaatcccttgctgggcctgctccagctaaagctgggcaagatc
gagctgtacgagcgcaactacaagcaggccttgcagcacctgcaggaggcgcagcgcata
ctgaacgtaacacatggccaagatcatcggctgttgctggagcagctgcgcccgctcatg
ctgcaggccaagcacgaaatgcgatga

DBGET integrated database retrieval system