KEGG   Drosophila arizonae: 108619949
Entry
108619949         CDS       T05886                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
daz  Drosophila arizonae
Pathway
daz04013  MAPK signaling pathway - fly
daz04214  Apoptosis - fly
daz04215  Apoptosis - multiple species
daz04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:daz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    108619949
   04391 Hippo signaling pathway - fly
    108619949
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108619949
   04215 Apoptosis - multiple species
    108619949
SSDB
Motif
Pfam: TNFR_c6 Macoilin PhoR Comm PepSY_TM
Other DBs
NCBI-GeneID: 108619949
NCBI-ProteinID: XP_017872279
LinkDB
Position
X
AA seq 427 aa
MSEMHPLMQRDSAASRAAAAAAARAAAAIGTAATATATATKLTTTSSSKCNNNNNNSLTL
TIMRPATKTNSKFHKRRRKRQRSEQCSNNSNNSNSSSNSCSNSSTATTATTAIRRRCSIP
YLSRTGAYLTLLLLTTTCSLCAVTAASTASASASTSTASSAATAAAAPASATSSSGSIGG
FVPPSSPCAPQHWWDQVQDKCMPCTSCQGEMIPLRPCQLHIDTVCRSIYELKIDWVVLAK
TEPNWKERRKSSEYEHFDQPTPLQHLTHEQLQQLHEEAAAALPLDWQTGALFIAVLACLL
FFSVAACILIHHMRQWRRMERRLDQDVEELSTKLMAKLAEVQSLDGGTFFIGNADALRGL
PASAMTAASAAASAAQSSLFQPQHVLLPVEKHTKHQERRILKTLQPGNVYIEENQGLGAG
VLANSKG
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgtcagagatgcacccgttaatgcaacgtgacagcgcagctagcagagcagcagcagca
gcagcagcaagagcagcggcggcaatcggaacagcagcaacagcaacagcaacagcaacg
aaattaacgacgacgagtagcagtaaatgtaacaacaataacaacaacagcttaacacta
actataatgcgcccagcaacaaaaacaaactccaaatttcacaaacgccgacgaaagcga
cagcggagtgaacagtgcagcaacaacagcaacaacagcaacagcagcagcaacagctgc
agcaacagcagcacagcaacaacagcaacaacagcaatccgtagaagatgtagcatccca
tatctaagcagaactggcgcctatctgacgcttctactgctaactacaacatgttccttg
tgcgctgttaccgccgcatccacagcctccgcctccgcctccacatccacagcctctagt
gctgccaccgcagctgccgcacccgcctctgccacgagcagcagcggcagcattggcggc
tttgtgccgcccagttcgccctgcgcgccgcagcattggtgggatcaggtgcaggacaag
tgcatgccttgcaccagctgccagggcgagatgataccgctgcgtccctgccagctgcac
atcgacaccgtttgccgctccatctacgagctgaagatcgactgggtggtgctggccaag
acggagcccaactggaaggagcgccgaaagtcatcggaatatgagcatttcgatcagcca
acgccgctgcagcacttgacccacgagcagctgcagcagctgcacgaggaggcagccgct
gcactgcccctcgactggcagacgggcgccctcttcatagcggtgctcgcctgcctgctc
ttcttctcggtcgccgcctgcatactcatccatcacatgcgccaatggcgccgcatggag
cgccgactggaccaagatgtggaagagttgtccacgaagctaatggccaagctggccgag
gtgcagagcctggacggtggcaccttcttcataggcaatgcggatgccctgcgcggactg
cccgcctcggcaatgacggccgcctcggcggcagcgtccgctgcgcagtcgagcctcttt
cagccgcaacatgtgctgctgcctgtggagaaacataccaagcatcaggagcgaaggatt
ctgaagaccctgcagccgggcaatgtgtatatcgaggagaatcaaggactcggcgctggc
gtcttggccaactcgaagggctga

DBGET integrated database retrieval system