KEGG   Desulfomicrobium baculatum: Dbac_0073Help
Entry
Dbac_0073         CDS       T00963                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dba  Desulfomicrobium baculatum
Brite
Enzymes [BR:dba01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dbac_0073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACU88203
UniProt: C7LSI9
LinkDB All DBs
Position
complement(93889..94485)
Genome map
AA seq 198 aa AA seqDB search
MIFVLPDLPYSKDALSPCISAKTLDFHHGKHHQLYIDNTNKLIAGTDLEGQTLREIVMAT
ANDPAKAGIFNNAAQVWNHSFYWRCMKAGGGGAPTGAVAEGINKAFGNYENFAKAFKEAG
MTQFGSGWAWLVEKNGKLEIMKTGNADTPMAHGAKALLTADVWEHAYYLDYQNRRADYLQ
DFLGKLINWEFVNQQLAK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatcttcgtgctcccggatcttccctactccaaggacgctttgagtccgtgcatcagc
gccaagaccttggactttcatcatggcaaacaccatcagctctacatcgacaataccaac
aagctgatcgcgggcacggatctcgaaggacagacgctgcgggaaattgtcatggccacg
gcgaacgacccggccaaggcgggcattttcaataacgcggcccaagtctggaaccactct
ttctactggcgttgcatgaaggccggcggtggcggagcacccaccggagccgtagccgaa
ggcatcaacaaggcatttggcaactacgaaaatttcgccaaggccttcaaggaagccggc
atgacccagtttggcagcgggtgggcatggctggtggaaaaaaacggaaagctcgagatc
atgaagaccggcaacgccgacacgcccatggcgcacggggccaaggccctgctcaccgca
gatgtctgggagcatgcctactacctcgattaccagaatcggagggccgattacctgcag
gatttcttaggcaagctgatcaactgggagttcgtcaaccagcaactcgccaagtag

DBGET integrated database retrieval system