KEGG   Desulfomicrobium baculatum: Dbac_0844Help
Entry
Dbac_0844         CDS       T00963                                 

Definition
(GenBank) Serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
dba  Desulfomicrobium baculatum
Pathway
dba00550  Peptidoglycan biosynthesis
dba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dba00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dbac_0844
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dba01002]
    Dbac_0844
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dba01011]
    Dbac_0844
Enzymes [BR:dba01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Dbac_0844
Peptidases [BR:dba01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Dbac_0844
Peptidoglycan biosynthesis and degradation proteins [BR:dba01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Dbac_0844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ACU88962
UniProt: C7LPB9
LinkDB All DBs
Position
917425..918630
Genome map
AA seq 401 aa AA seqDB search
MTKRYAAKFLFVLVIYALISGLAGIGFSAFASSGTHVFRGAVAPKPKIQAVAADSQIADR
AEPDTPAQSVPAASPAKAAASKKKTTTPAPDVVKKTAKTAPKQTDAAPKAPAVKAKKSAV
DKTKSAKPAVKPGTSKDLLLNAQAALLINMSTGDVYYEHNPDKTIAPASITKLLTLYIIR
EALAQGRLSQATPIPVSAEAVKTGGSRMRLKRNEKVPLGELIKGISVVSANNACVAVAEY
FGKGDPSKFVAQMNEKAKKIGMVNSRFKNPNGLPASGQLSTARDIAKLSVAYLRTFPESL
KVHSMTSHTFHGATHRNANTLLRTYKGVDGLKTGFVCDAGYNITATAKRGKTRLVAVVLG
AQNSAVRQRETARLLDYGFRRAADEEKLANKTSAAAKKPKA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaagatacgctgctaaatttttgttcgtattggtaatatatgccctgatcagc
ggattggccggaatcggtttttccgcttttgcgtcttcggggactcacgtttttcgggga
gcggttgcgcccaagcccaagatccaggccgttgcggcagacagccagattgcggatcgg
gctgaacccgacacgcctgctcagtccgttccggcagcatcccccgcaaaggctgcggca
tcgaaaaagaagacgaccacgcccgcgcccgatgtggtcaagaaaacggccaagaccgcc
ccaaaacaaaccgacgccgcgccaaaggctccggcggtaaaagccaaaaaatccgccgtg
gacaagaccaaatcggcgaagcctgccgtgaagccgggcacgtccaaggatttgttgctg
aacgcgcaggccgcattgctgatcaacatgtccactggcgacgtctattatgagcacaac
ccggacaagaccattgcgccggcatcgatcaccaagctcttgacgttgtacattatccgc
gaagccctggcccagggcaggctttcgcaggcgacccccattcccgtcagcgccgaggcg
gtcaagaccggcggttcgcgcatgcgtctcaagcgcaatgaaaaggtcccgcttggcgag
cttatcaagggtatcagcgtggtttcggccaacaacgcctgcgtggccgtggctgaatat
ttcggcaagggcgatccttccaagttcgtggcgcagatgaacgaaaaggccaagaagatc
ggaatggtcaacagccgcttcaagaatcccaacggcctgcccgcctcggggcagctctcc
accgctcgggacatcgccaagctgtccgtggcctatctgcgcacttttcccgaatcgctg
aaggtgcattccatgacaagccacacctttcacggcgccacgcatcgcaacgccaacacg
ctgcttcgtacatacaagggcgtggatgggctcaagaccggctttgtttgcgacgccgga
tacaacatcacggccacggccaagcgcggcaagacccggcttgtcgccgtggtgctcggt
gcccagaattccgccgtgcgccagcgcgagacggccagactgcttgattatggatttcgg
cgcgcggccgatgaagagaagctcgccaacaaaacctcggccgcggccaagaaaccaaaa
gcctga

DBGET integrated database retrieval system