KEGG   Desulfomicrobium baculatum: Dbac_1901Help
Entry
Dbac_1901         CDS       T00963                                 

Definition
(GenBank) protein of unknown function DUF81
  KO
K07090  uncharacterized protein
Organism
dba  Desulfomicrobium baculatum
Brite
KEGG Orthology (KO) [BR:dba00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Dbac_1901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: ACU89992
UniProt: C7LXC1
LinkDB All DBs
Position
complement(2193800..2194543)
Genome map
AA seq 247 aa AA seqDB search
MILYIASFFATLFFSALFATGGMGSSVVLIPILGFLGVDFNLAKAVGLFINTTTTSTASF
LNWRRQLLDFSTITPFLIASVCCAPIGTYCASIWNVEYIKLAFVIFLFFSSAKIFFKGRT
PHEETVKCKWAIFSLGLGVGFLAGLLGIGGGALIVPVLFAMGFSPMQIAINASFMIPFST
LSAFLSYAGFITIDWTLIGVTTIASMLGGFVGNRIMHAKLKNTDIKNVLCLVLCLVGFKM
LYDILAV
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatcctctacatcgccagttttttcgccacgctgttcttctcggctcttttcgcgaca
ggcggaatggggtcctctgtcgtgctcattccgattctgggattcctcggtgttgatttt
aatctggccaaggccgtcggcttgttcatcaacaccacgacgacctcgaccgccagtttc
ttgaattggcggcgacaactgctcgatttctccaccatcacgccatttctcatcgcgtcg
gtatgctgcgctccgatcggaacctactgcgccagcatctggaatgtggagtacatcaag
ctggctttcgtgatctttttgtttttttcttcggcaaagatctttttcaaaggtcgcaca
ccgcacgaggaaacagtgaagtgcaaatgggccattttctcgcttggtctcggtgtcggc
tttctggccggtcttctgggcatcggcggcggcgcgctcattgttccggttctgttcgcc
atggggttttcacccatgcaaattgccatcaacgccagcttcatgatccctttttcgacg
ctgtccgcttttctgagttacgccggattcatcacgatcgactggacgctcattggcgtg
acgactattgcaagtatgttgggcggatttgttggcaaccggatcatgcacgcgaaactc
aagaacaccgatatcaaaaatgtgctgtgccttgttttatgtttggtcggcttcaaaatg
ctttacgacattctggcggtataa

DBGET integrated database retrieval system