KEGG   Desulfomicrobium baculatum: Dbac_2135Help
Entry
Dbac_2135         CDS       T00963                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dba  Desulfomicrobium baculatum
Pathway
dba00564  Glycerophospholipid metabolism
dba01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dba00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dbac_2135
Enzymes [BR:dba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Dbac_2135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_3 HI0933_like Pyr_redox_2 NAD_binding_8 GIDA FAD_binding_3 Thi4
Motif
Other DBs
NCBI-ProteinID: ACU90219
UniProt: C7LNZ5
LinkDB All DBs
Position
2444675..2446234
Genome map
AA seq 519 aa AA seqDB search
MLRSDIIDQLGPGTTWDMIIIGGGATGLGCGVDAAGRGYKTLLLEERDFSQGTSSRSTKL
VHGGVRYLQQGNLALVMDALHERGVLLRNAPHLVYNQAFVVPDYKWWERPFYGVGLKLYD
MLAGKLGFGRSRVLSRAKTLNMIPNLEPTDLRGGVIYYDGQFDDSRLAITLARTMKDLGG
LPVNHMGVTGLIKDEDGLVCGVHARNSLTGESRELRAKIVINATGVFVDDIRRMDDEGAA
RLIAPSQGIHLVLDKSFSPGDTAIMVPHTDDGRVIFLVPWHGRVLVGTTDVALDSASPEP
RPMEEEITFLLEHAGRYLTRDPKRSDILSVFAGIRPLIRAEGEGKTSSLSRDHHLTISQS
GLVTIAGGKWTTYRKMGEDAVTQAARFAGLPPHSCKTENLPLHGWLSGVDPRDHLSVYGS
DIEEIREMIRRDPELGKPLHYKLPYLRAEVVWAVRREWARTLSDVLRHRTRALILDAAVS
MIIARDVAEIMARELDQGKDWIEEQVGSFRELARTYLAG
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctcagatcggatatcatcgaccaactcggcccaggcacaacctgggacatgatcatc
atcggcggcggggccacggggctgggctgcggcgtggacgcggccggccgtggatacaag
accctgctgctggaggagcgcgacttctcccagggcacctccagccgctccaccaaactt
gtccacggcggggtgcgctacctgcagcaaggcaacctggccctggtcatggacgccctg
cacgaacgcggcgtgctgctccgaaacgcaccgcatctggtctacaaccaggcctttgtc
gtgccggactacaaatggtgggagcgcccgttctacggcgtgggcctcaagctctacgac
atgctggccggcaagctgggcttcgggcgctcgcgcgtcctgtcgcgcgccaagaccctg
aacatgatccccaacctcgaacccacggacctgcgcggcggggtcatctactacgacggc
cagttcgacgactcccgcctggccatcaccctggcccgcaccatgaaagacctgggcggg
ctgccggtcaaccacatgggcgtaaccggactcatcaaggacgaggacggactggtttgc
ggcgtgcatgccagaaactctttgacgggcgagagccgcgagctgcgcgccaagatcgtc
atcaacgccacgggcgtgttcgtcgacgacatccggcgcatggacgacgagggcgcggcc
agactcatcgccccgtcccagggcatccatctggtcctggacaagtccttctcccccggc
gacacggccatcatggtcccgcataccgacgacggccgggtcatcttcctcgtgccctgg
cacggacgcgtgctggtcggaaccacggacgtggccctggacagcgcaagccccgaacca
cgacccatggaggaagagatcaccttcctgcttgaacacgcgggccgctacctgacccgc
gaccccaagcgcagcgacatcttgagcgtcttcgccggcatccggcccctgatccgggcc
gaaggcgaaggcaagacctcgtccctgtcccgcgaccatcacctgaccatctcccagagc
gggctggtgaccatcgcgggcggcaaatggaccacctaccgcaagatgggcgaggacgcc
gtgacccaggccgcgcgcttcgcgggcctgcccccccactcctgcaagaccgagaacctg
cccctgcacggctggctgagcggggtggacccgcgcgaccacctctcggtctacggcagc
gacattgaggaaatccgcgagatgatccgccgcgacccggaactgggcaagcccctgcac
tacaagctgccctacctgcgggccgaggtggtctgggccgtgcgacgtgaatgggcccgg
accctgtccgacgtgctgcgccaccgcacccgcgcgctgatcctggacgcggccgtgagc
atgatcatcgcccgcgacgtggccgagatcatggcccgtgaactggaccagggtaaagac
tggatcgaggaacaggtggggtctttccgggaactggcgcgaacctatctggcgggctga

DBGET integrated database retrieval system