KEGG   Desulfomicrobium baculatum: Dbac_2367Help
Entry
Dbac_2367         CDS       T00963                                 

Definition
(GenBank) extracellular solute-binding protein family 3
  KO
K10036  glutamine transport system substrate-binding protein
Organism
dba  Desulfomicrobium baculatum
Pathway
dba02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:dba00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Dbac_2367
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dba02000]
    Dbac_2367
Transporters [BR:dba02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Glutamine transporter
    Dbac_2367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 Phosphonate-bd HisG LPAM_1
Motif
Other DBs
NCBI-ProteinID: ACU90447
UniProt: C7LR41
LinkDB All DBs
Position
2725221..2725961
Genome map
AA seq 246 aa AA seqDB search
MKRILLFAVLALALCATTASAKKLIVATDTNFPPFEFKDPESGKHTGFDVELWDAIAKEI
GAEYDLQPMDFNGIIPGLQSGQIDVGIAGITIKPERAEVVDFSDPYYNAGLLILVKADNA
EITDVKSLAGKIVATKLGTTSEDFAKKEAGAKEVKLFPNNDAMFMELMAGGADAVIFDSP
VISEFVRTVGKEQTKIVGPLYMGQSYGIGFPKGSDLVAKVNEALKKLKDSGAYRELYIKW
FGTEPK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatcctgcttttcgccgttttagccctggccctgtgcgcgaccaccgcttca
gccaaaaagctgatcgtggccacggacaccaattttccgccgtttgaattcaaggacccc
gaaagcggcaaacacaccggcttcgacgtggaactctgggacgccatcgccaaggaaatc
ggcgcggaatacgacctgcagcccatggacttcaacggcatcatccccggcctgcagtcc
ggccagattgacgtcggtattgccggcatcaccatcaagcccgaacgcgccgaagtggtc
gacttctccgacccctactacaatgccggcctcctgatcctggtcaaggccgacaacgcc
gagatcaccgacgtcaaaagcctggccggaaagatcgtggccaccaagctcggcaccacc
agcgaagatttcgccaagaaggaagccggagccaaggaagtcaagctcttccccaacaat
gacgccatgttcatggaactcatggccggcggcgccgatgcggtcatcttcgactccccg
gtaatatccgaattcgtgcgcaccgtcggcaaggaacagaccaagatcgtcggccccctg
tacatgggccagtcctacggcatcggcttccccaagggcagcgacctggtcgccaaagtc
aacgaagccctcaagaagcttaaagacagcggcgcctaccgtgaactgtacatcaagtgg
ttcggcaccgagcccaagtaa

DBGET integrated database retrieval system