KEGG   Desulfomicrobium baculatum: Dbac_2788Help
Entry
Dbac_2788         CDS       T00963                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
dba  Desulfomicrobium baculatum
Brite
KEGG Orthology (KO) [BR:dba00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dba03012]
    Dbac_2788
   03029 Mitochondrial biogenesis [BR:dba03029]
    Dbac_2788
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dba04147]
    Dbac_2788
Translation factors [BR:dba03012]
 Eukaryotic Type
  Elongation factors
   Dbac_2788
 Prokaryotic Type
   Dbac_2788
Mitochondrial biogenesis [BR:dba03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Dbac_2788
Exosome [BR:dba04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dbac_2788
  Exosomal proteins of breast cancer cells
   Dbac_2788
  Exosomal proteins of colorectal cancer cells
   Dbac_2788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW ATP_bind_1
Motif
Other DBs
NCBI-ProteinID: ACU90864
UniProt: C7LU66
LinkDB All DBs
Position
complement(3168259..3169452)
Genome map
AA seq 397 aa AA seqDB search
MAKQKFERKKPHVNIGTIGHIDHGKTTLTAAITKIASLKGGGSFVAFDEIDKAPEEKERG
ITIATAHVEYETANRHYAHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGPMPQTREHI
LLARQVGVPYVVVFLNKVDLVDDEELIELVDMEVRELLSKYEFPGDDVPVIRGSALKALE
SDTADSEDAKCILELLDACDSYIPAPIRETDKPFLMPIEDVFSISGRGTVVTGRVERGIV
RVGEEVEIVGITDTRKTTCTGVEMFRKLLDEGQAGDNIGALLRGVKRDDVERGQVLAKPG
SITPHTKFSAEVYVLSKEEGGRHTPFFSGYRPQFYFRTTDITGVVTLDEGIEMIMPGDNT
TFHVHLINPIAMEKGLRFAIREGGRTVGAGVVSEIVE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcaaaaatttgaaagaaaaaagccgcacgtcaatatcggtacgattggtcat
atcgaccacggcaagacgacgttgaccgccgcaatcacgaagattgcgagcctcaagggc
ggcggatcctttgtagcgttcgatgagatcgacaaggctcctgaagagaaggaacgcggt
atcaccattgcaaccgcgcacgtcgagtacgagaccgccaatcgtcactatgcccacgtg
gattgccccggtcacgccgactacatcaagaacatgatcaccggcgcggcccagatggac
ggcgcgatcatcgttgttgcggccaccgacggtcccatgccccagactcgtgagcacatc
ctgctcgcccgtcaggttggcgttccttatgtcgtggtgttcctgaacaaggtcgacctt
gttgacgatgaagaattgatcgaactggtagacatggaagtgcgcgaactgctgtccaag
tacgagttccccggcgacgacgttccggtcatccgcggttccgccttgaaggcgctggaa
agcgacactgccgacagcgaagacgccaagtgcattcttgagctgttggacgcttgcgac
tcttacattcccgctccgattcgcgagaccgataagcccttcctgatgcctatcgaagac
gtgttctccatttccggtcgcggcactgtcgtcaccggtcgtgtcgagcgcggcatcgtg
cgcgttggcgaggaagtcgagatcgtcggtatcaccgatacccgcaagacgacctgcacc
ggcgttgaaatgttccgcaagcttcttgacgaaggtcaggccggcgacaacatcggcgcc
ctgcttcgcggcgtgaagcgtgacgatgttgagcgcggccaggtacttgccaagccgggc
agcatcaccccgcacacgaagttctctgcggaagtgtacgtcctgagcaaggaagaaggc
ggtcgtcatacacctttcttctccggctatcgtcctcagttctatttccgtacgacagac
atcaccggtgtggtgactctggatgaaggcatagaaatgatcatgcctggtgacaacacg
actttccatgtgcatctgatcaatccgatcgccatggaaaagggtcttcgcttcgcaatc
cgcgaaggtggacgtaccgttggcgctggtgttgtttccgaaatcgtggagtaa

DBGET integrated database retrieval system