KEGG   Desulfomicrobium baculatum: Dbac_2874Help
Entry
Dbac_2874         CDS       T00963                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
dba  Desulfomicrobium baculatum
Pathway
dba00500  Starch and sucrose metabolism
dba01100  Metabolic pathways
dba01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dbac_2874
Enzymes [BR:dba01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Dbac_2874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-ProteinID: ACU90949
UniProt: C7LUN4
LinkDB All DBs
Position
3256653..3259241
Genome map
AA seq 862 aa AA seqDB search
MQPLHVYTVVPKLPEKLLPLKTLASNLYFSWQHEIEEFFAQIDRELWEKSEHNPVWFLNH
LPQSTLEELGEDEFFLDRLSTIAAGFEKYLSKRSPMTGLDALESGPVVAYFSAEYGIAQC
LPVYSGGLGVLAGDHLKSASDLNIPLVGIGLCYQRGFFRQYLTHDGWQQERYQANDFEQM
PLSAVLDEDGLPLKVRFQMQGSPLYFRVWRADVGRVPLFLMDTNISENTPERRELTSQLY
GGDLEMRLMQEYLLGIGGIKALEAMGLSPRVIHMNEGHSAFAGLERIRVLMEDRHLSFEA
ALELVAQSSVFTTHTPVPAGNDRFSPELMAKYFQEYSADLGLSWKVFLALGRENTRDDAE
HFCMTILALRLSRFNNGVSRLHGKVSRKMWANVWPQYPEEDVPITWVTNGIHFPTWVAPE
MSVLYDRFLGQSWREDPDCERVGEKFGSIPDIELWRAHERLRERLVDFVRRRLQQQIISR
GGRSWELEAADNVLNPEALTIGFARRFASYKRAYLLLKDDDRLKRLVTDPARPVQFIFAG
KAHPRDNEGKKIIQELISLCQSPESRASMVFLEDYDMQVARYLVQGCDIWLNNPRRPLEA
CGTSGMKAMANGVLNLSTLDGWWDEAWSPDNSVGWAIGNAEEYDDVEYQDFVESQTLYNI
LEKDVIPLFYDRVQGSFPRRWVQKMKQALKTLGPVFNGHRMVEEYSKRAYLPANISYGKL
SAGGYRPVMDLADWRMNLLTHWGGLDIRNVQCVTAHEMFVGENLEVSAEVKVEGLGIQDI
RVEIYTGPLDHTGKFANRSTFAMSPDERTADGWYIYRGKAMPMATGKFGFTVRILPHHPL
LRDAHSLGLIFWADNPGPKLQG
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccattgcatgtttatacagttgtgcccaagcttccggaaaaacttctgccgctc
aagacgctggcaagcaacctctatttttcatggcaacatgaaatcgaggaattttttgcc
cagatagaccgcgaattatgggaaaaaagcgaacacaacccggtctggttcctgaaccat
ctgcctcagagcacactggaagaactgggcgaggatgaattctttctggaccgtctgtca
accattgcggcgggtttcgaaaaatacctgtccaagcgcagccccatgaccggactcgac
gctcttgagagcggacctgtggtcgcctatttcagcgccgaatacggcatcgcccaatgc
ctgcccgtgtattcgggagggcttggcgtgctggccggggaccatctcaaatccgccagc
gacctgaacatacccctggtcggaatcggattgtgctaccagcgcggatttttccgccag
tacctgacccacgacggctggcagcaggaacgctatcaggccaacgatttcgagcagatg
cccctctcggcggtgctggacgaggacggactgccgctgaaggtgcgcttccagatgcag
ggcagcccgctctatttccgcgtctggcgggcggacgttggccgcgtgcctcttttcctg
atggacaccaatatctccgaaaacacgccggaacgccgggagctgacctcccaactctac
ggcggggacctggagatgcggctcatgcaggaatatctgctcggcatcggcggcatcaaa
gcccttgaggccatgggcctctccccccgggtcatccacatgaacgaaggccactcggct
tttgccggcctggaaagaatccgcgtgctcatggaagaccgccacctgtcctttgaggcg
gccctggaactggttgcccagagctccgtcttcaccacgcacacacctgttccggcgggc
aacgaccgtttctccccggaactgatggccaaatacttccaggaatattccgcggacctg
ggactctcctggaaggttttcctggccttgggccgggaaaacacgcgcgatgacgccgaa
catttctgcatgaccatactggccctgcgcctgtcccggttcaacaacggcgtcagccgg
ctgcacggcaaggtttcgcgcaaaatgtgggccaatgtctggccccagtatcccgaagag
gacgtgcccatcacctgggtcaccaacggcatccatttcccgacctgggtggctcctgaa
atgtcggtcctctacgaccgtttcctgggccagtcgtggcgtgaagacccggactgcgag
agggtcggcgaaaaattcgggtccatcccggacatcgagctctggcgggcgcacgaacgc
ctgcgggagcgtctggtcgattttgtgcgccgccgcctgcagcagcagatcatatcccgg
ggcggccgcagctgggaactcgaagccgcggacaatgtcctcaatcccgaggcgctgacc
atcggtttcgcccgccgcttcgcgtcctacaaacgcgcctacctgctgctcaaagacgat
gaccgcctaaaacgcctcgttacggaccccgcccgcccggtacagttcatctttgccggc
aaggcccatccccgggacaacgagggcaagaaaatcattcaggagctcatcagcctctgc
cagtctccggagagccgcgcatccatggtctttctggaagactatgacatgcaggtcgcc
cgctacctggtccagggctgcgacatatggctcaacaacccgcgccgccctctggaggcc
tgcggcaccagcggcatgaaggccatggccaacggcgtgctcaacctgagcacccttgac
ggctggtgggacgaggcctggagcccggacaattccgtgggctgggccatcggcaacgcc
gaggaatacgacgatgtcgaataccaggacttcgtggagagccagaccctctacaacatc
ctcgaaaaagatgtcatcccgctcttctacgaccgcgtgcaaggctccttccccaggcga
tgggtgcaaaagatgaagcaggccctcaaaaccctggggccggtcttcaacgggcaccgc
atggtcgaggaatactccaagcgcgcctatctcccggccaatatcagctacggcaagctc
tcggcgggcggataccgcccggtcatggacctggccgactggcgcatgaacctgctcacc
cactggggcgggctcgatatccgtaacgtgcagtgcgtcacggcccacgaaatgtttgtc
ggtgagaacctggaggtcagcgccgaggtcaaggtcgagggcctcggcatccaggacatc
cgcgtggaaatctacaccggcccccttgatcacaccggcaaattcgcaaaccggtccacc
ttcgccatgagcccggacgagcgcaccgccgacggctggtacatataccgaggcaaggcc
atgcccatggccacgggcaaattcggcttcaccgtgcgcatcctgcctcaccacccgctg
ctgcgcgatgcgcacagtctggggctgatcttctgggccgacaaccccggaccaaaactc
caagggtag

DBGET integrated database retrieval system