KEGG   Desulfomicrobium baculatum: Dbac_3061Help
Entry
Dbac_3061         CDS       T00963                                 

Definition
(GenBank) Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+))
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
dba  Desulfomicrobium baculatum
Pathway
dba00620  Pyruvate metabolism
dba01100  Metabolic pathways
dba01120  Microbial metabolism in diverse environments
dba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dbac_3061
Enzymes [BR:dba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     Dbac_3061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: ACU91136
UniProt: C7LWA0
LinkDB All DBs
Position
complement(3463113..3464435)
Genome map
AA seq 440 aa AA seqDB search
MALFTPQEALDYHSEVRPGKVEVVPVKPYSTQKHLTMAYSPGVAESCLAIAKDPDLTYKY
TGRGNLVAVVSNGTAVLGLGNIGAYAGKPVMEGKGLLFKIFADVDVYDINLDVTDPDKLC
EIVKAMEPTFGGINLEDIKAPECFYIEDKLKKEMNIPVFHDDQHGTAIISAAGLINALEI
TGKKIEDLRIVVSGAGAAAISCTRLYVALGVKLENVAMFDSRGHMHAGRTDLNPQKREFA
TEKAYGSLAEAMVGADMFLGLSKGGVVSQDMVRSMGKNPIIFACANPVPEISYTEAKEAR
PDAIMGTGRSDFPNQINNVLGFPFIFRGALDVMASNINEEMKLAAAKALAALAKEPVPDY
VVEAYGVDKLEFGIDYIIPKPVDLRLIEFESAAVAQAAMDTGVARKPIADMDAYRVSLRE
RIAKSRERLDAFVKTYPQIF
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggctcttttcacgccccaggaagccctagattatcattccgaagtccgtcccggcaaa
gtcgaagtcgtgccggtcaagccctattccacccagaagcatctgaccatggcctacagc
ccgggcgtggccgaatcctgcctggccatcgccaaggatccggacctgacctacaagtac
acgggccgcggaaacctcgtcgccgtcgtgtccaacggcacggccgtgctgggtctgggc
aacatcggcgcctatgcgggcaagccggttatggagggcaaggggctcctcttcaagatt
ttcgcggatgtggatgtttacgacatcaacctcgacgtgaccgacccggacaagctctgc
gagatcgtcaaggccatggagccgaccttcggcggcatcaacctcgaagacatcaaggcc
ccggagtgcttttacatcgaggacaagctcaaaaaagaaatgaacatcccggtcttccat
gacgaccagcacggcacggccatcatctccgccgccggtctgatcaatgcgctggaaatc
acgggcaagaagatcgaggacctgcgcattgtcgtctccggcgcgggcgcggcggccatt
tcctgcacccggctctatgttgccctgggcgtgaagctcgaaaacgtcgccatgttcgac
tctcgcgggcacatgcacgccggtcgcacggacttgaatccgcagaagcgcgagttcgcc
acggaaaaagcctacggctcactggccgaagccatggtcggcgcggacatgtttctgggc
ctgtccaaggggggcgtggtcagtcaggacatggtccggagcatgggcaaaaacccgatc
atcttcgcctgcgccaatccggttcccgaaatctcctacaccgaggccaaggaagcccgt
cccgacgccatcatgggcacgggccgctcggacttcccgaaccagatcaacaacgtgctc
ggcttccccttcatcttccgcggggcactcgacgtcatggcctcgaacatcaacgaggaa
atgaaattggcggcagccaaggccctggcagctctggccaaggagccggtgccggactac
gtggtcgaggcgtatggcgtggacaagcttgaattcggcatcgactacatcatccccaaa
cccgtggacctgcgccttatcgagttcgaatccgccgccgtggcccaggccgccatggac
acgggcgtggcccgcaagcccatcgcggacatggacgcctaccgcgtgtccttgcgcgaa
cgcatcgccaaatcgcgcgaacgactggacgccttcgtgaagacctatccgcagattttc
tag

DBGET integrated database retrieval system