KEGG   Desulfarculus baarsii: Deba_0037Help
Entry
Deba_0037         CDS       T01284                                 

Definition
(GenBank) response regulator receiver protein
Organism
dbr  Desulfarculus baarsii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Cytidylate_kin2 FleQ
Motif
Other DBs
NCBI-ProteinID: ADK83416
UniProt: E1QD97
LinkDB All DBs
Position
48271..49491
Genome map
AA seq 406 aa AA seqDB search
MSVVNIFYGSFCDAEQVALAVAGRLGYRLASDEDLIALAAGLGKQGAGALRRVMYGKANI
FNSFSHEKERGLSLLKLAMSRMLAEDNLVFMGFGCHLTPKEVSHALRVCLAADTKFRVAK
AVRELGLNEREAGARVHRDDEAAFRWLEYLQNRQPWDAALYDMLIPMDKNSVDQAVELIC
RHAASPPLQPTAASRQAAADFALAAQVEMALAEEGHSTRDLAVTVKGGRARVEVNKKVLM
LGRLSDEVKRLVEGVDGVTAVEVEAGPGYHQADVYRRADFQLPSKVLLVDDEREFVQTLG
ERLLLREIGSAVVFDGEQALKVVAEDEPEVIVLDLKMPGIDGLEVLRRIKRDYPKVEVII
LTGHGSERDRDNCLQIGAFAYLEKPVDIEQLSQTMQQAYDKIRSGQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggtcaacattttttacggctcgttctgcgacgccgagcaagtggccctggcc
gtggccggtcggctgggctatcgcctggcctccgacgaagacctcatcgccctggccgcc
ggcctgggcaagcagggcgccggggccctgcgccgggtgatgtacggcaaggccaacatc
ttcaattcgttctcgcacgaaaaagagcggggcctcagcctgctcaagctggccatgtcg
cgcatgctggccgaggacaacctggtgttcatgggttttggctgccacctgacgcccaag
gaggtcagccacgccctgcgggtgtgcctggcggccgacaccaagttccgcgtggccaag
gccgtgcgcgagctgggcctgaacgaacgcgaggccggcgcgcgcgtccaccgcgacgac
gaggcggccttccgctggctggagtatctgcaaaatcgccagccctgggacgcggcgctc
tacgacatgctcatccccatggataaaaacagcgtcgaccaggccgtggagctgatctgc
cgccacgcggcctcgccgccgctgcaacccaccgccgcctcccgccaggccgcggccgat
ttcgccctggccgcccaggtcgagatggccctggccgaggagggccacagcacccgcgat
ctggccgtgacggtcaagggcggccgcgcgcgggtggaggtcaacaagaaagtgctgatg
ctgggccggctcagcgacgaggtcaagcgtctggtcgaaggcgtggacggcgtgacggcg
gtggaggtggaggctggcccgggctaccatcaggccgacgtctatcgccgggccgacttc
caactgccctccaaggtgctcctggtcgacgacgagcgcgagttcgtccagaccctgggc
gagcggctgctgctgcgcgagatcggctcggcggtggtcttcgacggcgaacaggccctg
aaggtggtggccgaggacgaaccggaagtcatcgtgctggacctgaaaatgcccggcatc
gacggcctggaggtgttgcggcgcatcaagcgcgactaccccaaggtcgaggtgatcatc
ctcaccggccacggctccgagcgcgaccgcgacaactgcctgcaaatcggcgctttcgcc
tatctggaaaagccggtggacatagagcagttgtcccagaccatgcaacaggcctacgat
aagatcaggagtgggcaataa

DBGET integrated database retrieval system