KEGG   Desulfarculus baarsii: Deba_1088Help
Entry
Deba_1088         CDS       T01284                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
dbr  Desulfarculus baarsii
Pathway
dbr00020  Citrate cycle (TCA cycle)
dbr00190  Oxidative phosphorylation
dbr00650  Butanoate metabolism
dbr01100  Metabolic pathways
dbr01110  Biosynthesis of secondary metabolites
dbr01120  Microbial metabolism in diverse environments
dbr01130  Biosynthesis of antibiotics
dbr01200  Carbon metabolism
Module
dbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dbr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deba_1088
   00650 Butanoate metabolism
    Deba_1088
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Deba_1088
Enzymes [BR:dbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Deba_1088
    1.3.5.4  fumarate reductase (quinol)
     Deba_1088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_10 Fer4_8 Fer4_17 Fer4_7 Fer4_9 Mtp
Motif
Other DBs
NCBI-ProteinID: ADK84456
UniProt: E1QIN3
LinkDB All DBs
Position
complement(1210975..1211685)
Genome map
AA seq 236 aa AA seqDB search
MEKIVFSILRYDPEKDKKPHYQDFDVEIRRPGMMILDGLNQIRWEQDGTLAYRRSCREGV
CGSDGVNVNGVNMLTCVTHITEVVKKGRLVIQPLPSLPLVKDLVVDLDDFFNKYFTVKPY
LISKTPPPHRERLQSPAQRKKLDGLYECILCACCSSSCPSYWANPEYLGPSAMLNVARFV
EDSRDDGADERLDMLEDRIGVWRCHTILNCVEACPKSLNPTQAIATLKKLLVQRRF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatagtcttcagcattctgcgttacgaccccgaaaaggacaaaaagccccac
taccaggacttcgacgtggaaatccggcggccgggcatgatgatcctcgacgggctcaac
cagatccgctgggagcaggacggcaccttggcctatcgccgctcttgccgcgagggcgtc
tgcggctccgatggcgtcaacgtcaacggcgtcaacatgctcacctgcgtgacccacatc
accgaggtggtcaaaaaaggccgcctggtcatccagcccctgcccagcctgccgctggtc
aaggacctggtggtcgacctggacgatttcttcaacaaatacttcaccgtcaagccatac
ctcatcagcaagacgccgccgccccaccgcgagcggctgcaatcgccggcccagcgcaag
aagctcgacggcctctacgaatgcatcctctgcgcctgttgcagttcctcgtgcccatcc
tattgggccaacccagaatatctgggccccagcgccatgctcaacgtcgcccgcttcgtc
gaggactcccgcgacgacggggccgacgagcgcctggacatgctcgaagaccgcatcggc
gtctggcgttgccacaccatcctcaactgcgtcgaggcctgccccaagtcactcaacccg
acccaggccatcgccacgctgaaaaaactcttggtgcaacgtcgcttctga

DBGET integrated database retrieval system