KEGG   Desulfarculus baarsii: Deba_1089Help
Entry
Deba_1089         CDS       T01284                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
dbr  Desulfarculus baarsii
Pathway
dbr00020  Citrate cycle (TCA cycle)
dbr00190  Oxidative phosphorylation
dbr00650  Butanoate metabolism
dbr01100  Metabolic pathways
dbr01110  Biosynthesis of secondary metabolites
dbr01120  Microbial metabolism in diverse environments
dbr01130  Biosynthesis of antibiotics
dbr01200  Carbon metabolism
Module
dbr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dbr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dbr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deba_1089
   00650 Butanoate metabolism
    Deba_1089
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Deba_1089
Enzymes [BR:dbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Deba_1089
    1.3.5.4  fumarate reductase (quinol)
     Deba_1089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-ProteinID: ADK84457
UniProt: E1QIN4
LinkDB All DBs
Position
complement(1211699..1213477)
Genome map
AA seq 592 aa AA seqDB search
MAIKSDIIVHRVDALVAGAGGAGLRAALEAGKQVDTAVITQVFPTRSHTVSAQGGIGASL
GNVEQDSWHYHMFDTVKGSDWLGDQDAIEFMCREAPSVVIELEHMGLPFSRMDDGRIYQR
AFGGHTSKYGTAAVHRSCAAADRTGHAMLHTLFEECLRCGVKFYNEYYMLQLITNQGHVC
GALCWDMIKGGFHLFHAKATLFATGGYARVFTTTSNAHICSGDGASLALRAGLAVQDMEF
LQFHPTGILGAGNLITEGVRGEGGFLLNALGQRFMETCAPHEKDLACRDVVSRGIAEELR
GGRGCGPKKDHVLLQIHHIGAETIMERLPGIWELTKVFAGVDCTKEPIPVVPTAHYSMGG
IPTNRRAEVVVPGADGPETVVPGFYAAGEAACASVHGANRLGTNSLLDLMVFGREGGRRM
AQYAQQNETWPDLPENAGKQGLAEVERLVNGGGGVRLGPLMEQLRDDMERHCGVFRTADD
LEQLRGKLAAHRAAYAKVGVADKGAAYNLDLIEALELGHMLDVCQAICQGALARQESRGG
HYRDDYPQRDDANWHKHTLALLEPDGQARLEYKPVRMQPLSVPTIDLAERKY
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggccatcaaaagcgacatcatcgtccaccgcgtggacgccctggtggcgggcgccggc
ggcgcgggcctgcgggcggccctggaagccggcaaacaggtcgacaccgccgtcatcacg
caagtcttccccacgcgcagccacaccgtcagcgcccagggcggcatcggggccagcctg
ggcaacgtcgagcaagactcgtggcattatcacatgttcgacaccgtcaagggctcggac
tggctgggcgaccaggacgccatcgagttcatgtgccgcgaggcgcccagcgtggtcatc
gagttggagcacatgggcctgcccttttcgcgcatggacgacggccgcatttatcagcgg
gcctttggcggccacacgtccaagtatggcacggccgccgtgcatcgctcctgcgccgcc
gccgaccgcacggggcacgccatgctgcacacgctctttgaggaatgcctgcgttgcggc
gtgaaattctataacgaatactacatgttgcagcttataaccaaccagggccatgtctgc
ggcgcgctctgttgggacatgatcaagggcggcttccatctgttccacgccaaggccacg
ctatttgccaccggcggttacgcccgggtcttcaccaccaccagcaacgcccacatctgc
tccggcgacggcgcgtccctggccctgcgggccggcctggccgtgcaagacatggagttc
ctgcaattccatcccacgggcatcctgggcgcgggcaacctgatcaccgagggcgtgcgc
ggcgagggcggctttttgctcaacgccctgggccagcgcttcatggagacctgcgcgccc
cacgaaaaagacctggcctgccgcgacgtggtcagccggggcatcgccgaggagctgcgc
ggcggccggggctgcggccccaagaaagaccacgtgctgttgcagatccaccacatcggc
gccgaaacgatcatggagcgcctgccgggcatctgggagctgaccaaggtcttcgccggc
gtcgattgcaccaaggagcccatccccgtggtgcccacggcccattattccatgggcggc
atccccaccaaccgccgggccgaggtggtcgtccccggcgcggacggccccgagaccgtc
gtgcccggcttctacgccgccggcgaggcggcctgcgccagcgtgcacggggccaaccgc
ctgggcaccaactccttgctggacctgatggtctttggccgcgagggcggccggcgcatg
gcccaatacgcccagcaaaacgaaacctggcccgatctgcccgaaaacgccggcaagcaa
ggcctggccgaagtcgagcgcctggtcaacggcggcggcggcgtgcgcctgggcccgctg
atggagcaactgcgcgacgacatggagcgccactgcggcgtctttcgcaccgccgacgac
ctggagcaactgcgcggcaaactggccgcccaccgcgcggcctacgccaaggtgggcgtg
gccgacaagggcgcggcctacaacctcgacctcatcgaggccctggagctgggccacatg
ctcgacgtctgccaggccatctgccagggggccctggcccgccaggaaagccgcggcggc
cactaccgcgacgactatccccagcgcgacgacgccaactggcacaagcacaccctggcc
ctgctggagcccgacggccaggcgcgcctggagtacaagcccgtgcgcatgcagccgctg
agcgtgccgaccatcgatctggccgagcggaaatattaa

DBGET integrated database retrieval system