KEGG   Desulfarculus baarsii: Deba_1912Help
Entry
Deba_1912         CDS       T01284                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
dbr  Desulfarculus baarsii
Pathway
dbr00970  Aminoacyl-tRNA biosynthesis
dbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dbr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Deba_1912
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dbr03029]
    Deba_1912
Enzymes [BR:dbr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Deba_1912
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Deba_1912
Mitochondrial biogenesis [BR:dbr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Deba_1912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ADK85277
UniProt: E1QL12
LinkDB All DBs
Position
2124562..2126022
Genome map
AA seq 486 aa AA seqDB search
MNYHDLTIAQASQLLAKGELSSVELTKAMLERVAATEERVHAYITLTPELALEQAANADK
MRAQGQAGPLTGVPAGVKDVLCTRGVATTCASRMLQNFTPPYSATLVRKLEAAGMVMLGK
HNMDEFAMGSSTENSAFGPTSNPWDLRAVPGGSSGGSAASVAARSCFYAIGTDTGGSIRQ
PASHCGVVGLKPTYGRVSRLGLVAFASSLDQAGPITRSVADAATVLQVIAGHDPADSTSA
PRPVPDYAAALRRGVKGLRLGVPKEYFVAGMDPQVEDAVRAAIATLEGLGAQVRPISLPH
AEYSLAVYYIIAPAECSSNLARYDGVKYGLSIRPEGADLLEMYTATRSQGFGKEVIRRIM
LGTYVLSAGYYDAYYNKASQVRTLLIEDFAAAFKEVDAIVTPVAPTPAFDKGQMTDDPMQ
MYLSDIFTLSCNLAGLPGMSLPCGFAQSGRPIGLQLMAPHFAEETLLAVGQAFQEATDFH
ARLAAI
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaactatcacgacttgaccatcgcgcaggccagccagttgctggccaagggcgagcta
tcctcggtggagctgaccaaagccatgctcgaacgcgtggccgccaccgaggagcgcgtc
cacgcctacatcaccctgacgcccgagttggccctggagcaggcggccaacgccgacaag
atgcgcgcccaaggccaggccggcccgctgaccggcgtgcccgccggcgtcaaggacgtg
ctctgcacccgtggcgtggccaccacctgcgccagccgcatgctgcagaacttcacgccg
ccctactcggccaccttggtgcgcaagctggaggcggccggcatggtcatgctgggcaag
cacaacatggacgagttcgccatgggcagctccaccgaaaactcggcctttggccccacc
agcaatccgtgggacttgcgggccgtgcccggaggctcctcgggcggctcggcggccagc
gtggccgcgcgttcgtgcttttacgccattggcaccgacaccggcggctccattcgccag
ccggccagccactgcggcgtggtcggcctcaagccgacctacggccgggtcagccgcctg
ggcctggtggcctttgccagcagcctcgaccaggccgggcccatcacccgcagcgtggcc
gacgcggcgaccgtcttgcaggtcatcgctggccacgacccggccgactccaccagcgcc
ccgcgccccgtgcccgactacgccgccgccctgcgacggggcgtcaagggcctgcgcctg
ggcgtgcccaaggaatacttcgtcgcgggcatggacccccaggtcgaagacgcggtgcgc
gcggccatcgccaccctggagggcctgggcgcccaagtgcgacccatcagcctgccccac
gccgaatacagtttggcggtctattacatcatcgccccggccgagtgcagcagcaacctg
gcccgctacgacggcgtcaagtatggcctgtccatccgcccggagggcgcggacttgctg
gagatgtacaccgccacccgctcccagggctttggcaaggaggtcatccggcggatcatg
ctgggcacatacgtgctcagcgccggctactacgacgcctattacaacaaggccagccag
gtgcgcacgctcttgatcgaggatttcgcggcggccttcaaggaagtcgacgccatcgtc
acgccggtggcccccactccggcctttgacaagggccagatgaccgacgatcccatgcag
atgtatctcagcgatatttttacgctatcgtgcaacttggcgggcttgccgggcatgagc
ctgccctgtggtttcgcccagagcggccggcccatcggcctgcaactgatggccccccac
tttgccgaggagacgctcttggccgtgggccaggccttccaggaggccacggactttcac
gcccgactggccgctatctga

DBGET integrated database retrieval system