KEGG   Desulfarculus baarsii: Deba_2690Help
Entry
Deba_2690         CDS       T01284                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
dbr  Desulfarculus baarsii
Pathway
dbr00500  Starch and sucrose metabolism
dbr01100  Metabolic pathways
dbr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Deba_2690
Enzymes [BR:dbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Deba_2690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-ProteinID: ADK86044
UniProt: E1QKF1
LinkDB All DBs
Position
2986082..2988637
Genome map
AA seq 851 aa AA seqDB search
MRPTISFEVRPKLPPALEPLKKLASNLWFVWNPEAQELWQRIDVDLWRKSRYNPVALLNQ
VHQERLASLAEDGGFIAQMERAASQLSQYMSTDYCPFLGGRAPENFTVAYFSAEYGMANC
LPIYSGGLGMLSGDHLKSASDLNIPLVGVGLAYRQGYFTQYLDHDGWQQEEYAANDFWNM
PMKLLHDDQGQEIRISVDIEGRPLIARAWRIDVGRVPLYLLDSGIEENPPDLRDITFQLY
GGDTQMRIRQEILLGIGGVRLLDKLGITYSVIHMNEGHSAFAALERIRLLRQKHGLNFDQ
AREIVRATGCFTTHTPVPAGNDYFDTDLVRRHFQGYVGELGISMPVLLGYGRVHPTDQNE
PLCMTVLALRLSAFNNGVSELHGQVSRQMWKDVWPHFPEEDVPIGHITNGVHTSTWINPD
IAYLYNRYLGPGWMEDPDSDAVWQGVDQIPDSELWQMHERRRAQMVSEVRQRLVRQFKRR
GGSARELAVCAESLRPDRLTIVFARRFATYKRAVLLLYDIDRLAAIVNHPERPVQFIFAG
KAHPKDNEGKEFIRRIVNLTHDERFRGKIVFVEDYDMGLARYLVQGADVWLNNPRRPLEA
CGTSGMKAAANGALNLSVLDGWWAEAFQPGIGWQIGQGEEYEDEGVQNMLEAGALYRLLE
NDVPSMFYYRDDQGLPREWIKHMKNCLRVVCPAFNSHRMVEDYVEMAYLPGGLRYAQLSR
DDFAGARELGGWVSMVMENWSQVQVQDVTSPIQGPLTWGQEVEVRAKVRLGQLTPSDVVC
DIYTGQLGPFGLFTDRRTFGMQPESEIEPGLWLFKGSFACDATGRMGLRVRLAPYHAGLG
SKYSLGLAAWG
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
gtgcgacccaccattagctttgaagtgcgacccaagctgccgccggccctggagccgctg
aagaaattggcctccaacctgtggtttgtttggaaccccgaagcccaagagctgtggcaa
cgcatcgatgtcgacctgtggcgcaaatcgcgctacaacccggtggccctgctcaaccag
gtgcaccaggagcgcttggccagcctggccgaggacggcggcttcatcgcccagatggag
cgggcggcctcgcagctttcacaatacatgtccaccgactactgccccttcctgggcggc
cgcgcgccggaaaacttcacggtggcctatttttcggccgaatacggcatggccaactgc
ctgcccatctattccggcggcctgggcatgctcagcggcgatcacctcaaaagcgccagc
gacctcaacatccccctggtcggcgtgggcctggcttatcgccagggctatttcacccaa
tacctcgaccacgacggctggcagcaggaagaatacgcggccaacgacttctggaacatg
cccatgaagttgctgcacgacgaccagggccaggagatccgcatcagcgtcgacatcgag
ggccggccgctgatcgcccgggcctggcgcatcgacgtgggccgcgtgccgctgtatctg
ctcgattcgggcatcgaggaaaacccgccggatctgcgcgacatcaccttccagctctac
ggcggcgacacccagatgcgcatccgccaggagatcctgctgggcatcggcggcgtgcgg
cttttggacaagctgggcataacctacagcgtcatccacatgaacgagggccacagcgcc
ttcgccgccctggagcgcatccgtctgctgcgccaaaagcacggcctcaacttcgaccag
gcccgcgagatcgtccgggccaccggctgcttcaccacccacaccccggtgcccgccggc
aacgactacttcgacaccgacttggtgcgccgtcatttccagggctacgtgggcgagttg
ggcatctcgatgccggtgcttctgggctatggccgggtgcaccccaccgatcagaacgaa
cccctgtgcatgaccgtgctggccctgcgcctgagcgccttcaacaacggcgtcagcgag
ttgcatggccaggtcagccgccagatgtggaaagacgtctggccccacttccccgaggag
gacgtgcccatcggccacatcaccaacggcgtgcacacctccacctggatcaaccccgac
atcgcctacctctacaaccgctatctgggccccggctggatggaagaccccgactccgac
gccgtctggcagggcgtggaccagatccccgacagcgagctgtggcagatgcacgaacgc
cgccgggcccagatggtctcggaagtgcgccagcgcctggtccggcagttcaaacgccgt
ggcggctcggcccgcgaactggccgtctgcgccgaatctttgcgccccgaccggctgacc
atcgtctttgcccggcgtttcgccacctacaagcgcgccgtgctcttgctctacgacatc
gaccgcctggccgccatcgtcaaccaccccgagcggcccgtgcagttcatcttcgccggc
aaggcccaccccaaggacaacgagggcaaggagttcattcgccgcatcgtcaacctgacc
cacgacgagcgtttccgcggcaagatcgtctttgtcgaggactacgacatgggcctggcc
cgctatctggtccagggggccgacgtctggctcaacaacccccgccggcccttggaggcc
tgcggcaccagcggcatgaaggccgccgccaacggcgcgctcaacctcagcgtgctcgac
ggctggtgggccgaggccttccagcctggcatcggctggcagatcggccagggcgaggag
tacgaagacgaaggcgtgcagaacatgctcgaggccggggcgctctatcgtctgctcgaa
aacgacgtgccctcgatgttctactatcgcgacgaccagggcctgccccgcgagtggatc
aagcacatgaaaaactgcctgcgcgtggtctgcccggccttcaacagccaccgcatggtc
gaggattacgtcgaaatggcctacctgcccggcggcctgcgctacgcccagttgtcgcgc
gatgatttcgccggggccagggagttgggcggttgggtctcgatggtcatggaaaactgg
agccaggtgcaggtgcaagatgtgaccagccccatccagggcccgttgacctggggccag
gaggtggaggtgcgggccaaggtgcgcctgggccaactcacgccaagcgacgtggtctgc
gacatctacaccggccagttggggcctttcggcctgttcaccgaccgccgcaccttcggc
atgcaacccgagagcgaaatcgaacccggactgtggctgttcaaaggctcctttgcctgc
gacgccaccggccgcatgggcctgcgcgtgcgcctggcgccttatcacgccggcctgggc
tcgaagtattcgctgggcctggccgcctggggctag

DBGET integrated database retrieval system