KEGG   Desulfotomaculum nigrificans: Desca_0490Help
Entry
Desca_0490        CDS       T01498                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca00473  D-Alanine metabolism
dca01100  Metabolic pathways
dca01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dca00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Desca_0490
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Desca_0490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dca01011]
    Desca_0490
Enzymes [BR:dca01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Desca_0490
Peptidoglycan biosynthesis and degradation proteins [BR:dca01011]
 Precursor biosynthesis
  Racemase
   Desca_0490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEF93383
UniProt: F6B7D3
LinkDB All DBs
Position
513487..514605
Genome map
AA seq 372 aa AA seqDB search
MQEPIWAEIDLGAIRHNIKEVRRLVGPDREIMAVVKANGYGHGAVPVARAALSAGATRLA
VARLNEAMVLRQAGINVPILVLGFIPPEQLATALTNHITLTLYRTDLAEEISRVAQKLGQ
PAVIHLKVDTGMGRLGFIPEQGIEEVKRVSQLAGLKLEGIYTHFAAADETDKSYTRWQLD
RFLSFISALEEQGVSFALRHCANSAAIIDHPEAYLDMVRPGIIIYGLYPSEEVNKSRVDL
RPAMALKTRVAHLKTVKPGTKISYGCTYTVPRETVIGSLPLGYADGYPRLLSSRGQVIIR
GQRAPIVGRVCMDQSMVDVGHIPGVKVGDEVLIFGRDGADYLPVEEVAAWLGTINYEMVC
LVGARVPRIYKE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaccaatttgggcggaaatagatttgggtgccattcggcacaacattaaggaa
gtaagaagattagtaggtcctgacagggaaattatggcggtggttaaggccaacggttac
gggcacggagctgttccggtggccagggctgctttaagcgccggggctacccggttggcg
gtggccaggctaaatgaggccatggttctacggcaagcgggaataaatgtacctatcctg
gtgctgggctttattcccccggaacagttggcaaccgcgttaaccaaccatattacctta
actctctaccggacagatttagccgaagaaatttcccgggtggcacaaaaattaggccaa
ccggcagtgattcatttgaaggtagacacgggtatggggcgactgggctttattccggag
caaggaatagaagaggttaaaagggttagccagttagctggtcttaagctggagggaatt
tacacccactttgccgcagcggatgaaactgataaatcctatacccgctggcagctggac
agatttttatcctttatcagtgctctggaggagcagggggttagctttgcgttacgtcac
tgtgccaatagcgctgcaattatcgaccatcctgaagcctacctggatatggttcggcca
ggcattattatctacgggctgtacccttccgaagaggtgaataaatcccgggtggatttg
cgcccggctatggctttaaagacccgggtagcccatttgaaaacggtcaaaccgggcacc
aagatcagctatggctgtacctacaccgttccccgggagacagtgattggctccctacct
cttggttatgctgacgggtatcctcgtttattgtcctcccggggccaggtgataattcgg
ggtcaacgggctcccattgtgggtagggtatgtatggaccagtccatggtggatgtgggg
catattcccggcgtcaaggtgggagacgaggtattaattttcggacgtgatggtgctgat
tacctgccggtggaggaagtggctgcctggcttggtaccattaattatgaaatggtttgc
ctggtgggggccagggtgccacgcatatacaaagagtag

DBGET integrated database retrieval system