KEGG   Desulfotomaculum nigrificans: Desca_0858Help
Entry
Desca_0858        CDS       T01498                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca00500  Starch and sucrose metabolism
dca01100  Metabolic pathways
dca01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desca_0858
Enzymes [BR:dca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Desca_0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: AEF93738
UniProt: F6B9G2
LinkDB All DBs
Position
943972..946515
Genome map
AA seq 847 aa AA seqDB search
MYFFRTVTVSPQLPERISRLKELSYNFWFSWQPKALELFERINRDKWQELNHNPVKLLLE
VSPDDLARMAGDQEYLNLYDQVMAELDQYMNNQTWFAEQYPDLAGKTIAYFSAEFGLHES
LPIYSGGLGVLAGDHCKAASDIGLPLVGVGILYKQGYFTQYINREGWQEAHYPFQKYNEM
PVRPALTEDGREVIIPVDLPGRVVYLKVWQVQIGRIKVYLLDADITLNSDHDRGLTAQLY
GGDRETRISQEILLGIGGVKALRYMGINPAAWHINEGHAAFLCIERLRELVQAGVPLATA
KEAVRASTIFTTHTPVPAGHDTFDPDRVHRYFNHYYGLLGVDRDSFMNLGWDPKSHSFNM
TILAMNLSAYCNGVSQLHGNVTRKMFHYLFDPIPVEEVPVFSVTNGIHILTWMSRELREL
LNSYLGTAWHGNISNPEPWHAIGNIPDRELWGLHKSLKKKTINFVRSILQKQKTRNQEAA
ENIAEVAEYLNPEALTIGFARRFATYKRATLLFRDKERLARIFSDPERPVQIIFAGKAHP
ADRAGQELIKYIYDISQEEPFKGKIIFIENYDMNVARHLVQGVDVWLNTPRWPMEASGTS
GMKAAVNGVINCSVLDGWWPEAYNGENGWAVGRETGYRTEDDQDRDDAFHLYSVLEDQII
PAYYNQTDGYPKEWVDRMKNSIKTITPQFSTERMVKEYTDRFYSQAVRRGEEFTANNFQV
ASQVQDYKRFIKDNWHHVTVKSVEVESDREFKAGEDMQLTATVYLGPIPPHDVAVEVVHG
CEGDHTLVGIKTSPLTVEGQSEEGVYRYKGGFTLEQGTCGFTVRIRPNNPKFATKFELPL
ASWAANF
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgtatttctttcgtacggttactgttagcccgcagttaccggagaggattagcagatta
aaggaactgtcttataatttttggtttagctggcagcccaaagccctggaactatttgaa
agaattaatcgcgataaatggcaggagttaaatcataatccggtaaaattgttactggaa
gtaagcccggatgatttggcccggatggctggggatcaggaatatctgaatttatacgat
caggtcatggctgaactggatcagtatatgaacaatcagacctggtttgccgaacaatat
cccgatttggccggcaagaccattgcttacttttctgccgagtttggcctgcacgaatcc
ttacctatttattccggtggtttgggcgtgttggccggggaccattgtaaagccgccagt
gacattggcttacccctggtgggggtaggcatactttataagcaaggctattttacccag
tatataaatcgagagggttggcaggaggcccattacccgttccaaaagtataatgaaatg
ccggtgcggcctgcccttacggaggatggccgggaagtaattatcccggtggatttaccg
ggcagggtggtctatcttaaagtatggcaagtgcagattggcaggattaaagtctattta
ttggatgctgatataaccttaaacagtgaccacgatagaggattaaccgcccagctttac
ggcggtgaccgggaaactcggatatctcaagaaatactgttgggcattggcggggttaag
gccttaagatacatggggatcaacccggcagcctggcatattaacgagggccatgccgcg
ttcctatgcatcgaaagattgcgagaactggtgcaagccggtgttcccctggccacagcc
aaggaggcagtgagagccagcactatttttaccactcacacaccggtaccggcgggtcat
gatacttttgacccggacagagtacatcgctatttcaaccactactatgggctgctgggt
gtagacagggatagctttatgaacctgggttgggatcccaaaagtcatagttttaacatg
accatattggccatgaacttgtcggcatattgtaatggtgtgagccaactgcatggaaac
gttacccgtaagatgtttcattatctgtttgatcctattccggtggaagaggtgcctgtt
ttctccgttaccaatggtattcatatcctgacctggatgtcccgggaactgcgtgaatta
ctgaattcttacctgggtactgcctggcatggtaacattagcaatccggaaccctggcac
gcgataggtaatattcctgatcgggaattatggggtttacataaatccctaaagaaaaag
actatcaattttgtccgaagtatattgcaaaaacaaaaaacccgcaaccaggaggcagcc
gaaaatattgctgaggttgctgagtatcttaaccccgaggcccttaccattggttttgcc
agacgctttgccacttataagcgggccaccttactgtttagagataaggagagattggcc
aggattttcagtgacccggagcgacctgtgcaaataatttttgccggaaaagctcacccg
gccgatcgggcaggccaggaattaatcaaatatatttatgatatatctcaggaagagccc
ttcaagggtaagattattttcattgaaaattatgatatgaatgtggccaggcatttggta
cagggagttgatgtttggctcaataccccccgctggcccatggaagccagtggcaccagt
gggatgaaggcagcagtcaacggggtaattaactgcagtgtgctggatggatggtggccg
gaagcttacaacggagaaaatggctgggccgtgggtagagaaaccggttatcgtaccgag
gatgatcaggatagagacgatgccttccatctttactccgtattagaggatcaaattata
cctgcttactataaccaaaccgatggttatcccaaggaatgggtggaccgcatgaaaaat
tccataaaaaccatcaccccgcagtttagtaccgagcggatggttaaggaatacacggat
cgtttctacagtcaggccgtccgccggggggaggaatttaccgctaacaattttcaggta
gccagccaggttcaggattacaaacggtttattaaagacaactggcatcatgtgactgtc
aaatcggtggaggtggaaagtgatcgggaatttaaagccggggaagacatgcaattgacc
gccactgtttatctgggaccgataccaccgcatgatgtggcggtagaagttgtgcatggt
tgtgagggggatcatactttagttgggattaagacatcccccttgacggtggaaggccaa
agtgaagaaggagtttaccgatataaagggggctttaccctggagcagggcacttgtggt
ttcactgtgcgcatccgacccaacaaccccaagtttgccaccaagtttgaactacctctg
gccagctgggcggctaatttctaa

DBGET integrated database retrieval system