KEGG   Desulfotomaculum nigrificans: Desca_1165Help
Entry
Desca_1165        CDS       T01498                                 

Definition
(GenBank) DNA polymerase LigD, ligase domain protein
Organism
dca  Desulfotomaculum nigrificans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AEF94029
UniProt: F6B3K0
LinkDB All DBs
Position
1280384..1281334
Genome map
AA seq 316 aa AA seqDB search
MNSVLPKIKPMLAVKTAPFDNSDFLYEIKWDGYRGLAYLDDKTIILSRNQLDLTPSFPEL
HGLHLKVKQRPTLLDGEIVVLQDGKPSFGALQGRGKITDSLKVARLARQTPATFIAFDIL
FRAGENVMDLPLKTRKEILNELVEQGPDLIISQYVVGSGLDFFDAVSSAGLEGVMAKRLD
SPYLPGKRSSYWKKIRRIQSAELVICGWEKGEGHRSLGSLILAGFDHGRWVYMGKVGTGF
TEDEEMRLLALLQPLVIESPVLAVPKAELRFPTWVKPEIVCEVTFTEISHEGRLRHPSYK
GTRPDKMPEECPPIQN
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcagttttacccaaaataaaacccatgttggctgtcaaaaccgctccctttgac
aattcagattttttatatgaaattaagtgggacggttaccgggggttggcctaccttgat
gacaagaccattatattatcccgcaaccaactggatttaacacccagctttccagagtta
catggactgcatttaaaggttaaacaacggccaaccttgttagacggggaaatagttgtg
ttacaagacggtaaaccatcctttggcgccctacagggtaggggtaaaatcactgattcc
ctcaaggtggccagattagccaggcaaacaccggccacctttatcgcttttgatatactg
tttcgggctggggaaaatgtgatggatctaccgttgaaaaccagaaaagaaatattgaat
gaactggttgagcagggcccagacctgattatttcccaatatgtagtgggttctggcctt
gatttttttgacgccgtcagctcagcggggttagaaggggtgatggccaaaaggctggac
agcccctacttgcctggcaaaagatcaagctattggaagaagattagaaggattcagtcc
gctgaactggtgatttgcggttgggaaaaaggggaagggcatagaagtttgggttcttta
attctagccggctttgaccatggcaggtgggtttatatgggcaaggtgggaaccggtttt
actgaggacgaggagatgagattattagcattactacagcccctggtgatagaatcaccg
gttttagcggtgccaaaggcggaactgcgatttcccacttgggttaaaccggaaatagtc
tgtgaagttactttcaccgaaatcagccacgaaggcaggttaagacaccccagttacaag
ggaacccgtccggataaaatgcctgaagaatgtccaccgattcaaaactaa

DBGET integrated database retrieval system