KEGG   Desulfotomaculum nigrificans: Desca_1522Help
Entry
Desca_1522        CDS       T01498                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:dca00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Desca_1522
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dca03400]
    Desca_1522
Enzymes [BR:dca01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Desca_1522
DNA repair and recombination proteins [BR:dca03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Desca_1522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AEF94377
UniProt: F6B6K3
LinkDB All DBs
Position
complement(1648722..1649630)
Genome map
AA seq 302 aa AA seqDB search
MTAETATEVMIEGKKLKLTNLNKIMWPEGLTKAHLVKYYTDIAPYLLPHLKGRPIVMKRY
PHGIEGEFFYQKDCPDYAPEWISTTTIIHSAKKVNYIICNDVATLVWLANQGCIEIHAWL
SANPAVEYPNIAVIDLDPGDEATFEDVMRVALVVRQALNQLKLKGFPKTSGASGMHVFIP
INPVYSFQEVTKAMGFVAKLVTSTYASKATIERSLDKRSKNKVYVDYLQNTRGKSMAWTY
SLRPLPGAPVSTPLLWEEIESLAIDPRQFNMHNILGRLHLFGDLFAPMANQMQELDHILA
MG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgactgcggaaacggcaaccgaagttatgatagagggaaaaaaactaaaactgaccaat
ttaaataagataatgtggcccgaggggttgaccaaagcacatttagtaaagtattatacg
gacattgcgccatatttgttacctcatcttaaaggacgaccaattgtcatgaagcgatac
ccgcacgggattgaaggggaattcttttatcaaaaagattgtccggattatgccccggaa
tggatcagtaccactaccattattcattccgctaagaaagtcaattatataatatgtaat
gatgtagccacgctggtttggttggctaaccagggctgcattgaaatccatgcctggtta
tcggccaatccggcagtggaataccccaatatagcagtaatagatttggaccctggagat
gaagctacctttgaggatgttatgagagtagctttggtggtaagacaagcattaaaccag
ttaaaattaaaaggtttccctaaaacctccggtgccagtggaatgcatgtttttattccc
attaacccggtttattctttccaggaggtaacaaaagctatgggttttgtggctaaatta
gttaccagtacatatgccagcaaggctaccattgaaaggtcgttggataaaagaagtaaa
aataaggtttatgttgactacttacaaaataccaggggtaaaagtatggcttggacctac
agcttgcgacctttacccggggcaccggtatcaacgcccttgctatgggaagaaattgaa
agtttagccatagatcccaggcaatttaatatgcataatattttaggcaggctacatttg
tttggagatttatttgcacccatggccaaccagatgcaagaactagatcacattttagcc
atggggtag

DBGET integrated database retrieval system