KEGG   Desulfotomaculum nigrificans: Desca_1720Help
Entry
Desca_1720        CDS       T01498                                 

Definition
(GenBank) glycosyl transferase group 1
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca00500  Starch and sucrose metabolism
dca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desca_1720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dca01003]
    Desca_1720
Enzymes [BR:dca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Desca_1720
Glycosyltransferases [BR:dca01003]
 Polysaccharide
  Storage polysaccharide
   Desca_1720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_transf_5 Glyco_trans_4_4 Glyco_trans_1_2 Glyco_trans_4_2 Glycogen_syn PIGA
Motif
Other DBs
NCBI-ProteinID: AEF94568
UniProt: F6B7L4
LinkDB All DBs
Position
complement(1844327..1845571)
Genome map
AA seq 414 aa AA seqDB search
MRKVCGNLRVVVFSWEYPPISVGGLAQHVFDLTQAMAKQGDDIHVITRGNGSIPDFENVQ
GVKVYRVNPFKVSSTDFVTWVMQLNMAMLETVIPLLNELDVEIIHAHDWLVAYAAKVCKH
AYHIPLISTIHATEWGRHNGLHNDMQRHISDIEWWLTYESWRVICCSHYMHGELRHVFQL
PADKIRIIPNGVNPGNFKFSADTTYHRDTYAAPDEKIVYYVGRLVPEKGVQVLLDAVPKI
LYYHPKTKFVIAGTGPFADELKNKANQMGIGHKVYFTGYVNDLARNSLYHYADVAVFPSL
YEPFGIVALEAMAAQTPVVVSDTGGLGEIIHHGVNGMKAYTGNANSLADNILHCLMDPVS
ARRMREQAYRDVLEQYNWDNIARETKKVYQEIINENRHTHWQRVEHKNTKFMQQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaggtgtgtggcaatttgagggttgttgtattttcctgggaatatccgcctatt
agtgtaggtggcctggcccagcacgtttttgatttaacccaggccatggctaaacaaggt
gatgatattcatgtaataacccggggtaacggaagtatacctgattttgaaaatgtccag
ggtgttaaagtttaccgggtaaatccatttaaagtttcatctactgattttgttacttgg
gtcatgcaattaaatatggccatgctggaaacagtcatcccactgttaaacgaattagat
gttgaaattatccatgcccatgattggttggtggcatatgcggctaaggtttgcaagcat
gcctatcacatccctctgatttctaccatccatgccaccgagtggggtaggcataacggt
ttgcataatgatatgcaaagacatatcagtgacattgaatggtggttaacctatgaatcc
tggcgggttatttgttgcagtcattatatgcacggagagttaaggcatgtttttcaattg
cccgcggataaaattagaataattcccaacggtgttaatccggggaattttaaattcagc
gccgatactacataccatagagatacctatgcggctccggatgagaaaatagtctattac
gtggggcgcctggtgcctgaaaaaggggtgcaggtactgttggatgctgttcctaaaatt
ctttattaccaccctaagactaaatttgttattgccggtaccggaccttttgccgatgaa
ttaaagaataaggccaatcaaatgggtattggccacaaagtttattttaccggttacgtc
aatgatttagcccgcaatagcttatatcattatgcggatgtggcggtctttcccagtcta
tatgaaccctttggtattgtggcactggaggcaatggcggctcagacgccggtggttgtt
tcagatacaggtggtctgggtgaaatcattcatcacggggtaaatggtatgaaggcctat
accggcaatgccaattctttggccgataatattttacattgtctgatggatcctgtgtcc
gcccggcgcatgcgtgaacaagcctaccgcgatgtgctggagcaatataactgggacaat
attgccagggaaaccaaaaaagtttatcaagaaattataaatgagaatcgccatacccat
tggcagcgggtagagcataaaaataccaaattcatgcaacaataa

DBGET integrated database retrieval system