KEGG   Desulfotomaculum nigrificans: Desca_2471Help
Entry
Desca_2471        CDS       T01498                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase, anaerobic, A subunit
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dca  Desulfotomaculum nigrificans
Pathway
dca00564  Glycerophospholipid metabolism
dca01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Desca_2471
Enzymes [BR:dca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Desca_2471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 Pyr_redox_2 FAD_oxidored Fer2_BFD GMC_oxred_N FAD_binding_3 DAO_C
Motif
Other DBs
NCBI-ProteinID: AEF95298
UniProt: F6B4C1
LinkDB All DBs
Position
complement(2591518..2593122)
Genome map
AA seq 534 aa AA seqDB search
MKTDKTQVVVIGGGATGTGILRDLVLRGISGILVEQGDLAHGTSSRFHGLLHSGARYAVK
DQAAARECLEENKILRRIAANCVEPIGGLFVQAPGDDPAYVDRWVAACQDAGIDPEEIDV
QELLQANPVLGTNITRAFKVPDAAVDGFRVLWGNVNSARRYGAKIMTYTRVTAIHQSNGR
VTGVEVTNQLTGAKQFIECETVINAAGAWAGEIAALAGLELKVIKDKGTLVAFNHRLMNR
VVNRLRPPGDGDIFVPHGTITILGTTSMTVDNPACSQPEQSEVLSLLQIGRELVPELENY
RMIRAFAGVRPLYQPGNAAEGRAVTRNFALLDHQQLDGLTGFVSIVGGKFTTFRLMAEKT
VDLVAARLGVNKPCRTAEEPLTAPVADELLQRGKKVFGIPGAQKAAERLGDDFAKVVEQA
EQKPELQKMFCECELVSLAEISHVAQDETCFALGDIRRKTRMGMGTCQGTFCSYRTLGAL
AKYDRFAGNHRAYLSNFLQKRWKGIRPVLWGQQLREAQLSTAIYSSLFGMERMK
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggataaaactcaggtggtggtaataggtggcggggccaccggaaccggtatt
ctccgtgacctggtcctccggggtatatccgggatactggtagaacagggggacctggcc
cacgggaccagttctcgcttccacgggctgctccatagcggggcccgttatgcggtgaag
gatcaagcagcggcccgggagtgcctggaggagaataaaattttgcgccggattgcggcc
aactgtgtggaacccattggcggactttttgtacaggcacccggagatgacccggcttat
gttgaccggtgggttgccgcctgtcaagatgcgggtattgatcctgaggaaatagatgta
caggaactgttacaggctaaccctgttttggggaccaatatcaccagggcctttaaagta
ccggatgcggcggtggacggttttcgggtgctttggggaaatgttaattcggcccggcgt
tacggggccaaaatcatgacctataccagggtcactgccatccaccaaagtaacggtcgg
gttaccggggtagaggtaaccaatcaactgaccggggcaaaacagttcattgagtgtgag
acggtgattaacgccgccggtgcctgggccggtgaaatagccgccctggctggcctggaa
ctaaaggtgattaaggataagggtacgttggtggcctttaatcacaggctgatgaaccgg
gtagttaaccgactgcggccgccgggggacggggatatttttgttccccacggcaccatt
actatcctgggtaccacctccatgaccgttgataacccggcttgcagccaaccggaacaa
agcgaagtgctcagtctgttgcaaattggccgcgagctggtgccggagttagagaattat
cggatgattcgggccttcgccggggtgcggcccctataccagccgggtaatgccgctgag
gggcgggctgtcacccgtaactttgctttactggatcaccaacagttggacggtttaacc
ggttttgtcagcattgtcggcggtaagtttaccaccttccgtctgatggccgaaaaaacg
gtggatttggtggccgcccggctgggggtcaataaaccctgtcggacagcggaagaaccc
ttgaccgcccccgtggccgatgaattattgcagcgggggaaaaaggtctttggaataccc
ggggcgcaaaaggccgccgagcgactgggggacgactttgccaaggtggtggaacaggcg
gagcaaaaacccgagctacaaaaaatgttctgtgagtgtgaactggtcagcctggcggaa
attagtcacgtggcccaggatgaaacatgttttgccctgggtgatatccgccgtaagacc
agaatgggcatgggcacttgccaggggaccttttgcagctaccgtaccctgggggccctg
gccaaatatgaccgatttgccggcaatcaccgggcttatttaagcaatttcttgcagaaa
cggtggaagggtatcaggccggttttatggggacaacaattgcgggaagcacaattatca
acggccatttatagctcactatttgggatggagagaatgaaatga

DBGET integrated database retrieval system