KEGG   Deinococcus soli: SY84_11495Help
Entry
SY84_11495        CDS       T04233                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dch  Deinococcus soli
Pathway
dch00010  Glycolysis / Gluconeogenesis
dch00020  Citrate cycle (TCA cycle)
dch00620  Pyruvate metabolism
dch01100  Metabolic pathways
dch01110  Biosynthesis of secondary metabolites
dch01120  Microbial metabolism in diverse environments
dch01130  Biosynthesis of antibiotics
dch01200  Carbon metabolism
Module
dch_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SY84_11495
   00020 Citrate cycle (TCA cycle)
    SY84_11495
   00620 Pyruvate metabolism
    SY84_11495
Enzymes [BR:dch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SY84_11495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H RnfC_N PYNP_C HlyD_3 PTS_EIIA_1 NQRA DUF2254
Motif
Other DBs
NCBI-ProteinID: AKH17559
UniProt: A0A0F7JQI6
LinkDB All DBs
Position
2349424..2351151
Genome map
AA seq 575 aa AA seqDB search
MATELKLPDVGDNIEQGTVVTVLVKAGDSVTEGQPIIEIETDKAVIEVPAEATGTVEAVN
VTVGDTVKVGGVIATLSGGTSTPAAPASGPVDEAEVGSSKAVAQAQQDAQKEQAGEAAAP
AASAPVASAGGQITLPDVGDNIEQGTVVSVLVKEGDTVSEGQPVIEIETDKAVVEVPANA
GGTVTGVNVKVGDTVKVGGVIATLGGGSAPAAPASAPAPAAPAAAPAASTPASAPSVVKV
NISGGEQPAAQFPKSQGTQNPQTFDGRTVVAAAPSVRRLARELGVDIHAVHGTGIAGRIS
EEDVRRTGGTPTVTTPAAAPATSTPAAAAPAVAAAPLPDFTKWGTVTREDMSGIRKATVR
SMTASTAIPMVTHFDKADVTVMEEVRKRFGARVEKAGGKLTMTHILMKVVANALRKFPKF
GASLDLDAQQVIYKDFVNIGVAVDTPVGLLVPVVKDADRKSITDLVLELSELAAKARDRK
LKPDEMQGATFTISNLGGIGGHAFTPIVNSPEVAILGVSRGGMEPVWNREKGEFEPRNML
PISLTYDHRLIDGADAARFVRFICESLEDPFLISL
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgaactgaaactgcccgacgtgggcgacaacattgagcagggcacggtcgtg
acggtgctcgtgaaggccggggacagcgtgaccgaggggcaacccatcatcgagatcgag
accgacaaggctgtcatcgaggtgcccgccgaggccaccgggaccgtggaggccgtgaac
gtgaccgtgggcgacaccgtgaaggtcggcggtgtgatcgccaccctcagcggcggtacc
agcaccccggccgcccccgccagcggcccggtcgacgaggccgaggtcggcagcagcaag
gcggtcgcgcaggcgcagcaggacgcgcagaaggaacaggccggtgaggcggccgcgccc
gccgcctccgctccggtcgccagcgccggcgggcagatcaccctgccggacgtgggcgac
aacatcgagcagggcaccgtcgtcagcgtcctcgtgaaggaaggcgacacggtcagcgag
ggccagcccgtcatcgagatcgagacggacaaggccgtcgtggaagtccccgccaacgcg
ggcggcaccgtgaccggcgtgaacgtgaaggtcggggacaccgtcaaggtgggcggcgtg
atcgccaccctgggcggcggcagcgcccccgccgcaccggccagcgcgcccgccccggct
gcccctgcggccgccccggcagcctccacgccggccagcgcccccagcgtcgtgaaggtg
aacatcagcggcggcgagcagcccgccgcacagttccccaagtcgcagggcacccagaac
ccccagaccttcgacggccgcaccgtcgtggccgccgcgcccagcgtgcgccgcctcgcg
cgggaactcggcgtggacattcacgccgtgcacggcaccggcatcgcgggccgcatcagc
gaggaggacgtgcgccgcaccggcggcacccccaccgtcaccacgcccgccgccgccccg
gccaccagcacccccgcggccgccgccccggccgtggccgccgcgccgctgcccgacttc
acgaagtggggcaccgtcacccgcgaggacatgagcggcatccgtaaggccaccgtccgc
tccatgaccgccagcaccgccatccccatggtcacgcacttcgacaaggccgacgtgacc
gtcatggaagaggtccgcaaacgcttcggcgcgcgcgtggagaaggcgggcggcaagctc
accatgacccacatcctcatgaaggtcgtcgcgaacgccctgcgcaaattccccaaattc
ggcgccagcctcgacctcgacgcccagcaggtcatctacaaggacttcgtgaacatcggc
gtcgctgtcgatacgcccgtcggcctgctcgtgcccgtcgtcaaggacgccgaccgcaag
agcatcaccgacctcgtcctcgaactgagcgaactggccgccaaggcccgcgaccgcaaa
ctgaaacccgacgagatgcagggcgccaccttcacgatcagcaacctcggcgggatcggc
gggcacgccttcacgcccatcgtgaacagccccgaagtcgccatcctcggcgtgagccgc
ggcggcatggaacccgtctggaacagggagaagggtgagttcgaaccccgcaacatgctc
cccatcagcctcacctacgaccaccgcctgatcgacggcgccgacgccgcccgcttcgtg
cgcttcatctgcgagtcgctggaagaccccttcctgatctcgctgtaa

DBGET integrated database retrieval system