KEGG   Deinococcus soli: SY84_12955Help
Entry
SY84_12955        CDS       T04233                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dch  Deinococcus soli
Pathway
dch00620  Pyruvate metabolism
dch00680  Methane metabolism
dch01100  Metabolic pathways
dch01120  Microbial metabolism in diverse environments
dch01200  Carbon metabolism
Module
dch_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:dch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SY84_12955
  09102 Energy metabolism
   00680 Methane metabolism
    SY84_12955
Enzymes [BR:dch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SY84_12955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase DUF438 PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AKH17786
UniProt: A0A0F7JN08
LinkDB All DBs
Position
complement(2660492..2662987)
Genome map
AA seq 831 aa AA seqDB search
MSIRSDVNLLGRTLGQVLKEQEGEAFFELVERTRALVREVRAGGSDAELRAMLAGLSGPD
AGNLARAFTWYFQLVNLAEEYERVRVLAASGGVRPQSLAQAMQELRAQGLTAEEVEALLA
RLDLGLTFTAHPTEMRRRTVRRHLEQVARAIPTLSDGGVDGPEAAGIAAHVEALWRTPEL
RRLKPTVLDEVKGGLTYVSSIAQALPALQRDLHAAFREVFGRDTAATLPLSFSSWMGGDR
DGNPFVTPQATRETLALHGERAREVLLGLIRQAFADLSQEDEGEEAYREELQSLFDAVQD
GQTLDLVGHLEALEARLIRDGQRRTAEQLLSPLLTVARVFGQHLVSLDVREHSAQTGAAV
AELLRAAGVEADYAALPEHAKQELLIRELRSRRPLWPAGEGLPDTLETAVGPIREVRDAV
RRAGPRAFGRYVISMAESVSDVLEPLILAREVGLRILPVPLFETLDDLQRAPQVVWELLS
LPEYRAVLGDDVQEIMLGYSDSNKDTGFLAANWALHEAQRQISDVCRRAGVRWRFFHGRG
TSIGRGGGPASRAILGQPAGTIDAGLRITEQGEALADKYSHPVLARRNLEQALYGLLLSA
ARPAGELNPAWTDAMTRAAASSARAYRALVDDPAFLPFFEHVTPIHEIARLNIASRPVRR
PGAPTLGNLRAIPWVMSWTQNRANLPGWYGLCEGLQEIGVETAREMYATWPFFRTVLDNA
QMSLAKSDPLIFDEYLRLLPEGDAHPLATHLKDAYARTVALVQDVVGAELMANEPRLRES
ISLRNPYIDPIHRIQVELLRRSRGKDGGLDEFERPLLLSIQGIAAGVRNTG
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcggagtgatgtgaacctgctgggccgcacgctggggcaggtgctgaaggaa
caggagggcgaggcgttcttcgagctggtggagcgcacgcgcgccctggtgcgcgaggtg
cgcgccgggggcagcgacgcggagttgcgcgcgatgctggccgggctgtccggtccggac
gcggggaacctggcgcgggcgttcacgtggtacttccagctggtgaacctggccgaggag
tacgagcgggtgcgggtgctggccgcgtcgggtggggtgcggccgcagagtctggcgcag
gcgatgcaggaactccgcgcgcagggcctcacggctgaagaggtcgaggcgctgctcgca
aggctggatctgggcctgacgttcacggcgcacccgaccgagatgcgtcgccgcacggtg
cgccgtcacctggagcaggtggcgcgcgccattccgaccctcagtgatgggggcgtggac
gggccggaggcggccgggatcgccgcgcacgtggaggcgctgtggcgcacgccggaactg
cgccgcctgaaacccaccgtgctggacgaggtgaagggcggcctgacgtacgtgtcgagc
atcgcgcaggccctcccggccttgcagcgggacctgcacgcggcgttccgggaggtgttc
gggcgggacacggcggcgacgctgccgctgagcttctcgtcgtggatgggcggggaccgc
gacgggaatccgttcgtgacgccgcaggcgacgcgcgagacgctggcactgcacggcgaa
cgggcgcgcgaggtgctgctgggtctgatccggcaggcgttcgcggacctgagtcaggag
gacgagggcgaggaggcgtaccgcgaggagcttcagagcctgttcgacgccgtgcaggac
gggcagacgctggatctggtgggccacctggaggccctggaggcccgcctgatccgcgac
gggcagcggcgcacggcagagcagctgctgtcgccgctgctgacggtcgcgcgggtattc
gggcagcacctcgtgagcctggacgtgcgcgagcacagcgcgcagacgggcgcggcggtc
gcggagctgctgcgcgccgcgggcgtggaggccgattacgccgcgctgcccgagcatgcc
aagcaggaactgctgatccgggagctgcgctcgcgccgtccgctgtggcctgccggggag
gggctgcccgacaccctggagacggcggtcggcccgatccgcgaggtacgggacgcggtg
cgccgcgccgggccgcgcgcgttcggccggtacgtgatcagcatggccgagtcggtcagc
gacgtgctcgaaccgctgatcctggcgcgagaggtgggcctgcgcattctgccggtcccg
ctgttcgagacgctggacgacctccagcgcgcgccgcaggtcgtgtgggaactgctctcg
ctgcccgagtaccgcgcggtgctgggcgacgacgtgcaggagatcatgctgggctacagc
gacagcaacaaggacacggggttcctcgcggcgaactgggcgctgcacgaggcgcagcgg
cagatcagtgacgtgtgccgccgcgccggggtgcgctggcgcttcttccacgggcgcggc
accagcatcggccgtggcggtggtccggccagccgcgccatcctcgggcagcctgccggg
accatcgacgcggggctgcgcatcaccgagcagggcgaggcgctggccgacaagtacagc
cacccggtcctggcgcggcgcaacctggaacaggcgctgtacgggctgctgctgtccgcc
gcgcgcccggccggagagctgaatcccgcctggacggacgccatgacccgcgccgccgcg
agcagcgcccgcgcgtaccgcgcgctggtggacgacccggcgttcctgccgttcttcgag
cacgtcacgcccatccacgagatcgcccgcctgaacatcgcctcccgtccggtgcgccgc
cccggcgcgcccacgctgggcaacctgcgcgccattccgtgggtgatgagctggacgcag
aaccgcgccaacctccccggctggtacgggctctgcgagggcctgcaggagatcggcgtg
gagaccgcccgcgagatgtacgccacgtggccgttcttccgcacggtgctcgacaacgcg
cagatgagtctcgccaagagcgacccgctgatcttcgacgagtacctgcgtctgctgccc
gaaggggacgcgcacccgctcgccacgcacctcaaggacgcctacgcccgcacggtcgcg
ctggtgcaggacgtggtgggtgccgaactcatggcgaacgagccgcgcctgagagaaagc
atcagcctgcgcaacccgtacattgacccgattcaccgcattcaggtggaactcctgcgc
cgcagccgcggcaaggacggcggtctggacgagttcgagcgtcccctgctcctgagcatc
cagggcatcgcggcgggcgtgcgcaacaccggctga

DBGET integrated database retrieval system