KEGG   Dermatophilus congolensis: SAMEA4475696_0626Help
Entry
SAMEA4475696_0626 CDS       T05038                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dco  Dermatophilus congolensis
Pathway
dco00010  Glycolysis / Gluconeogenesis
dco00030  Pentose phosphate pathway
dco00051  Fructose and mannose metabolism
dco00052  Galactose metabolism
dco00680  Methane metabolism
dco01100  Metabolic pathways
dco01110  Biosynthesis of secondary metabolites
dco01120  Microbial metabolism in diverse environments
dco01130  Biosynthesis of antibiotics
dco01200  Carbon metabolism
dco01230  Biosynthesis of amino acids
dco03018  RNA degradation
Module
dco_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAMEA4475696_0626 (pfkA)
   00030 Pentose phosphate pathway
    SAMEA4475696_0626 (pfkA)
   00051 Fructose and mannose metabolism
    SAMEA4475696_0626 (pfkA)
   00052 Galactose metabolism
    SAMEA4475696_0626 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    SAMEA4475696_0626 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SAMEA4475696_0626 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dco01009]
    SAMEA4475696_0626 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dco03019]
    SAMEA4475696_0626 (pfkA)
Enzymes [BR:dco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SAMEA4475696_0626 (pfkA)
Protein phosphatases and associated proteins [BR:dco01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SAMEA4475696_0626 (pfkA)
Messenger RNA biogenesis [BR:dco03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SAMEA4475696_0626 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: SNV19079
UniProt: A0A239VAW0
LinkDB All DBs
Position
1:705851..708142
Genome map
AA seq 763 aa AA seqDB search
MNTNQHDPHTDTPCRIAILTSGGDAQGMNAAVRAVVRTAIHAGAEVYAIWEGYQGAVEGT
ITPIQWDDVGGTLAKGGTIIGTARSADFRTREGMRRAAKNLLQLGIDRIVAIGGDGSLAG
THAFRHHWPELLEELLAAGEIDQSTAKAHPALMVAGLVGSIDNDLIGSDMTIGADSAMHR
ILEAIDAISSTAASHQRTFVIEVMGRHCGYLPLFAAIAGGCDYVFVPEAPPEPGWENDLA
TKIRDGRAAGRRDSLILVAEGAQERDGTPITCERVQAAIHDTTGEDAKITILGHVQRGGT
PSAYDRWMSTLLGYAAAQEVLEATPDQPAHIIGVRSGRIARIDLVEAVTATGNIAATVAA
GNYSDAVRARGTEFLEGVELFRRLSRPEDGPREDRPGYGKRLAIMHIGGLAPGMNAAARA
AVRLGMQRGLTVLGITGGVPGLLDDDIHERSWADVDSWVGLGGAELGVRRMVPDLEHLYA
ISRTLEKHDVDALMLIGGYNAYLTAHRMLTESERYPALAIPIMCVPASIDNNLPFSELSI
GSDSALNRAIWALDAIKESGTASQRCFVTETMGRKCGYLALMAGIATGAERVYLHEEGVT
LDDLTRDVKHMNAAFKDGRRLFLAIRNERANERYTADFMARLFEQEAHGLYDVRTAVLGH
IQQGGSPSSNDRILAARLIGGAIRDIVEQLSAGRHEGRCVGLIEGEVRLNRLDRIMEHLD
VVNRRPKEQWWMGLRPVITALSDPDAVWSGEHIPVLRERPINS
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacaaaccaacacgacccccacaccgacaccccttgccgcatcgccatcctcacc
agcgggggagacgcccaaggcatgaacgctgccgtccgggctgtagtccgtaccgccatc
cacgccggcgctgaggtttacgccatctgggagggataccaaggcgcagtcgaaggcacc
atcacccccatccaatgggacgacgtcggcggcaccctcgccaaaggcggcaccatcatc
ggcaccgcacgctcagccgacttccgcacccgagaaggtatgcgccgcgccgccaagaac
ctcctacaactgggcatcgaccgcatcgtcgccatcggcggcgacggatcactcgccgga
acacacgcattccgccaccactggcccgaactactcgaagaactcctcgccgccggagaa
atcgaccaaagcaccgcaaaagcacaccccgcactcatggtcgctggcctggtcggctcc
atcgacaacgacctcatcggcagcgacatgaccatcggtgctgactccgccatgcaccgc
atcctcgaagccatcgatgcgatctcctccaccgctgccagccatcaacgcaccttcgtc
atcgaagtcatgggtcgccactgcggctacctgcctctctttgccgccatcgccggtggc
tgcgactacgtcttcgtccctgaagcaccacctgaacccggatgggaaaacgacctcgcc
acaaaaattcgcgacggccgtgccgcaggccgtcgcgacagcctcatccttgtcgcagaa
ggagcccaagaacgcgacggcacccccatcacctgcgagcgcgtccaagccgcaatccac
gacacaacaggcgaagacgcaaaaatcaccatcctcggacacgttcaacgaggcggaacc
cccagcgcctacgaccgatggatgtccaccctgcttggctacgccgctgcacaagaagtc
ctcgaagcaacccctgaccaacctgcccacatcatcggagtccgatcagggcgcatcgcc
cgcatcgaccttgtcgaagccgtcacggccaccggcaacatcgcagccactgttgccgca
ggcaactacagcgacgccgttcgtgcccgcggaaccgaattcctcgaaggcgtcgaactg
ttccgtcgtctctcgcgccctgaagacggccctcgtgaagaccggcccggctatggaaaa
cgcctagccatcatgcacattggtggcctcgctcctggcatgaacgctgccgcccgagcc
gctgtccggttaggcatgcagcgcgggctgaccgttctaggaattaccggcggtgtgcct
ggtctgctcgatgatgacatccatgaacgttcctgggctgacgtcgattcatgggttggt
cttggaggcgctgaacttggtgtccgacgcatggtgcctgaccttgaacacctctacgcc
atctcccgcaccctggaaaagcatgatgtcgatgccctcatgcttatcggtggatacaac
gcctatctcactgcccaccgcatgctcaccgaatccgaacgctacccagcactcgccatc
ccgatcatgtgcgtgccagccagcatcgataacaatctgcctttctctgaactctcaatt
ggttcagactctgccctaaaccgcgctatctgggcactcgatgccatcaaagaatccggc
accgcctcgcagcgttgcttcgtcaccgaaaccatgggccgtaaatgcggttatctggct
ctcatggcaggcattgctacgggtgctgagcgtgtctaccttcacgaagaaggagtcact
cttgatgacctcacccgcgacgttaaacacatgaatgccgctttcaaagacggacgacgt
ctcttcctagcaatccgcaacgaacgtgctaacgaacgctacacagctgatttcatggcc
cgtttgtttgagcaagaagcacacggtctctatgacgttcgcactgctgtccttggtcac
attcagcaaggcggcagcccatctagcaatgaccgtattcttgctgcccggctcattggg
ggagcaatccgcgacattgtcgagcagctctcagcaggtcgtcacgaaggccgttgcgtc
gggttgattgaaggtgaagttcgtcttaaccgtctggaccgcatcatggaacatctcgat
gtcgttaatcgcaggcccaaagaacaatggtggatggggctgcgtccagtcatcactgcg
ctctctgaccctgatgcggtgtggagcggagaacacattccggtgctgcgtgaacggccg
atcaattcgtga

DBGET integrated database retrieval system