KEGG   Dermatophilus congolensis: SAMEA4475696_1994Help
Entry
SAMEA4475696_1994 CDS       T05038                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dco  Dermatophilus congolensis
Brite
KEGG Orthology (KO) [BR:dco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SAMEA4475696_1994 (ahpF)
Enzymes [BR:dco01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SAMEA4475696_1994 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 Glutaredoxin HI0933_like FAD_binding_3 Thi4 AlaDh_PNT_C DAO NAD_binding_8 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: SNV24137
UniProt: A0A239VPF4
LinkDB All DBs
Position
1:complement(2246315..2247889)
Genome map
AA seq 524 aa AA seqDB search
MSVLDSTLTASLKQYLEMLEQPIELVATLDDRPKSGEMKDLLNEIAALSDKVTARFDGTN
ARTPSFDVVRTGTDVSVTFAGLPMGHEFTSLVLALLQVGGRAPKEDEALLNAIAALEGDY
EFTTYMSLTCQNCPTVVQALNMMSVVNPRIRHTAVEGSLFQDEIQEKNIMAVPAVYLNGE
LFDQGRMEAAEILAKIDAEGAAQRSAEALGKVDPVDVLVVGGGPAGVAASIYAARKGIPT
ALVADRLGGQVNDTMAIENLISVPYTEGPKLSGDLQEHMKQYDVTVVKNQQATKLLPAGE
DGYVTVEFGDAALKGKTVILATGARWRKMGIPGEDDYRNKGVSNCPHCDGPLFKGKRIAV
VGGGNSGVEAAIDLAGVVEHVTLFEFLPEMKADEVLQRKLRSLDNVDIILNARTSEVLGD
GTSVTGLDYEDRETGEIKHVDLQGIFVQIGLLPNTEWLGEAVQMSDRKEIVIDEHGATSV
PGVFAAGDCTVAPYKQIVTAFGAGATAALGAFDHLIRTSAPAEA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgtcctggattccacactgaccgcgtcgttgaagcagtacttggagatgttggag
cagcccattgagttggttgccacgctcgatgatcgcccaaagtcgggcgagatgaaggat
ctgctgaacgagatcgcagcgttgtctgataaggtgacggctcgttttgatggtacgaat
gcgcgtacgcccagctttgatgtggtgcgcacgggcacggatgtgtcagtgacgttcgcg
ggtttgccgatggggcatgagttcacgtcgttggtgttggctctgctgcaggtgggcggc
cgtgctccgaaagaggacgaggcgctcttgaacgccattgcggcgctggaaggcgactac
gagttcacgacatacatgtcgttgacgtgccagaactgccccacggtggtgcaggcgctg
aacatgatgagtgtggtgaacccgcggatccggcacacagcggtagaggggtcgctgttc
caggatgagatccaagagaagaacatcatggccgtgccggctgtgtacctcaacggtgag
ctgtttgatcagggccgcatggaggccgctgagatcctggccaagattgatgctgaaggg
gctgcacagcgttcagctgaagcgctgggcaaagtcgatccagttgatgtgctggtggtt
ggtggaggccctgccggtgtggcggcttcgatttatgctgcacgtaagggtattcctacg
gctttggttgctgaccgtttgggtggtcaggtcaatgacacgatggcgatcgagaacctt
atctctgtgccgtacaccgaaggaccgaagctttccggtgacctgcaggagcacatgaag
cagtatgacgtcaccgtggtgaagaaccagcaggcaaccaaactgttgccagctggtgag
gacggctatgtgacggttgagttcggcgatgctgcgctgaagggcaagacggtcatcctg
gccacgggagctcggtggcgcaagatgggcattcctggtgaggatgactaccgcaacaag
ggtgtttctaactgcccgcactgtgatggcccgttgttcaagggcaagcgcatcgcagtt
gttggtgggggtaactcaggtgttgaggctgcgattgacctggctggtgtcgttgagcac
gtgaccttgtttgagttccttccggagatgaaggctgatgaggtgcttcagcgcaagctg
cgcagtttggacaacgtcgacatcattcttaatgcgcgcacgagcgaggtgttgggtgat
ggcacgtcagtgacggggctggactatgaagaccgcgaaactggcgagattaagcacgtg
gacttgcagggaatcttcgtgcagatcggtctcttgccgaacaccgaatggctaggtgag
gcagtgcagatgtctgatcgtaaggaaattgtcatcgatgagcacggtgcaacgagcgtg
ccaggtgtgttcgctgccggtgactgcaccgttgctccgtacaagcagattgtgactgct
tttggtgctggtgctactgctgcgctgggtgctttcgatcacctcattcgcacgagcgct
cctgctgaggcctga

DBGET integrated database retrieval system