KEGG   Daucus carota (carrot): 108192311Help
Entry
108192311         CDS       T05350                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00010  Glycolysis / Gluconeogenesis
dcr00053  Ascorbate and aldarate metabolism
dcr00071  Fatty acid degradation
dcr00280  Valine, leucine and isoleucine degradation
dcr00310  Lysine degradation
dcr00330  Arginine and proline metabolism
dcr00340  Histidine metabolism
dcr00380  Tryptophan metabolism
dcr00410  beta-Alanine metabolism
dcr00561  Glycerolipid metabolism
dcr00620  Pyruvate metabolism
dcr00903  Limonene and pinene degradation
dcr01100  Metabolic pathways
dcr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108192311
   00053 Ascorbate and aldarate metabolism
    108192311
   00620 Pyruvate metabolism
    108192311
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108192311
   00561 Glycerolipid metabolism
    108192311
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    108192311
   00310 Lysine degradation
    108192311
   00330 Arginine and proline metabolism
    108192311
   00340 Histidine metabolism
    108192311
   00380 Tryptophan metabolism
    108192311
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108192311
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    108192311
Enzymes [BR:dcr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     108192311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 108192311
NCBI-ProteinID: XP_017227935
UniProt: A0A175YC39
LinkDB All DBs
Position
Unknown
AA seq 538 aa AA seqDB search
MAARRLSSFLLSRSPSLSSTSPFHSQGSYSILTRGINRFGTAAVAEEPIAPPVEINYTKL
LINGQFVDSASGKTFPTLDPRTGGVIADIAEGDAEDINRAVSAARKAFDEGPWPKMTPYE
RSRILLRFADLLEKHNDDVAALEAWDSGKPYEQAANAEIPLVVRLFRYYAGWADKIHGLT
VPADGPHHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNSVVLKSAEQTPLTALY
AAKLFHEAGLPPGVLNVVSGYGPTAGAALASHMDVDKLAFTGSTETGKAVLGLAAQSNLK
PVTLELGGKSPFIVCEDADIDEAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKAK
ARAMKRIVGDPFKKGVEQGPQIDSEQFEKILGFIRSGNESNATLECGGGRFGSKGYYVQP
TIFSNVQDGMLIAQEEIFGPVQSILKFKDVNEVIRRANASKYGLAAGVFTKNIDTANTLM
RALRVGTVWINCFDVFDAAIPFGGYKMSGTGREKGIYSLQNYLQVKAVVTPLKNPAWL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcagccagaaggctctcttctttcttgctctctcgttctccatctctttcatctact
tctcccttccactcacaagggagctactctatcctcacaaggggcatcaacaggtttggc
actgctgcagtagctgaggaacccattgctccacctgttgaaatcaattacaccaagctt
ctaatcaatggccagtttgtggattctgcatctggtaaaacatttccaactttggatcct
cgaactggcggagtaattgcagacattgctgaaggagatgcggaagatatcaatcgcgca
gtgtctgctgcgcgcaaggcatttgatgaaggaccatggccaaaaatgaccccttatgaa
agatctcggatcttgttgcgctttgcagatttgcttgagaaacacaatgatgacgttgca
gcgcttgaagcatgggacagtgggaagccttatgaacaggctgccaatgctgaaatacca
ctcgttgtccgcctatttcgctactatgctggttgggcagataaaatccatggcctcaca
gttccagctgatggaccacaccatgtgcaaactttgcatgagcccataggtgttgctgga
cagataattccttggaactttcctctcctcatgtttgcttggaaagttgggcctgcattg
gcatgcggtaattctgttgtcctaaaatctgcagagcaaacaccactgactgctctctat
gcggcaaaactgttccatgaggctggtctccctcctggtgttttaaatgtagtttctggc
tatggtccaacagctggtgcagctctagccagtcatatggatgtggacaagcttgctttt
actggctcaacagaaactggaaaggccgtacttggattggctgcacaaagcaatcttaaa
ccagtgacattagagctcggaggaaaatcaccgttcattgtctgcgaggatgctgacatt
gatgaagctgtggagctagcacactttgccctgttttttaatcaggggcaatgctgttgt
gctggttctcgtacattcgttcatgaacgtgtttatgatgaattcttagaaaaagcaaaa
gctcgtgcaatgaaacgtatagttggtgatcccttcaagaagggtgttgaacaaggtcct
cagatagactcggagcaatttgagaaaattctcgggttcatacgatctggtaatgaaagc
aatgccacccttgaatgcgggggaggaagatttggctccaaaggatactacgtccaacct
actatattctcaaatgttcaggatggtatgttgatagcacaggaagaaatttttggcccg
gtgcagtcgatcctgaaattcaaggacgtgaatgaagtgatcagaagagccaacgcctca
aaatatggtctagctgctggagtttttaccaaaaacatcgatacagctaacaccttgatg
cgagctctcagggttggtacagtatggataaactgttttgatgtgttcgatgctgcaatt
ccgtttggtggttataaaatgagtgggactggcagggaaaaagggatctacagccttcaa
aactatctgcaagtgaaggctgttgtcactcccttgaagaatcctgcatggttgtag

DBGET integrated database retrieval system