KEGG   Daucus carota (carrot): 108196143Help
Entry
108196143         CDS       T05350                                 

Definition
(RefSeq) DNA ligase 6 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr03030  DNA replication
dcr03410  Base excision repair
dcr03420  Nucleotide excision repair
dcr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108196143
   03410 Base excision repair
    108196143
   03420 Nucleotide excision repair
    108196143
   03430 Mismatch repair
    108196143
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dcr03032]
    108196143
   03400 DNA repair and recombination proteins [BR:dcr03400]
    108196143
Enzymes [BR:dcr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     108196143
    6.5.1.6  DNA ligase (ATP or NAD+)
     108196143
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     108196143
DNA replication proteins [BR:dcr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    108196143
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     108196143
DNA repair and recombination proteins [BR:dcr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     108196143
   NER (nucleotide excision repair)
    Other NER factors
     108196143
   MMR (mismatch excision repair)
    Other MMR factors
     108196143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DRMBL Lactamase_B_2 RMMBL
Motif
Other DBs
NCBI-GeneID: 108196143
NCBI-ProteinID: XP_017218765
LinkDB All DBs
Position
7
AA seq 1401 aa AA seqDB search
MASKTLTLDSSSLFLNSLNSTPSPLTPFPTDFPQSKRIPNSRFIVDGFRHAGDHSVSYFL
SHFHSDHYTGLSPNWSKGIIYCSQITARLLVEVLKVPAAFVVSLPMSEIVVVDDCEVRLV
DANHCPGAVQFLFKVRVSDGGFERYVHTGDFRYCDDMKLDDALCEFVGADVVYLDTTYCN
PKFVFPVQDESVDYIVEAINRIGVENVDKSKSVLFLVATYVIGKERILVEIARRCNRKIH
VDRRKMDILGVLGFGEDEVFTEDESESDVHVVGWNVLGETWPYFRPNFVMMNEIMAAKGY
SKVVGFVPTGWTYEVKRNKFAVRTKDSFEIHLVPYSEHSNYEELREYVKFLKPKRVIPTV
GVDVEKLDSKHALAMQKHFAGLVDEMAVKQDFLKSFHRGARNSSDKPTNVNTAGIEEKDL
ASDEVQTFENIDSELHDQAPVPQDILLVNDNDIEELVQELHDCLPAWVTRDQMLDLLQSS
NKDVVEAVSYFYEHEIEFHEQAAASTSSLCKSQPGSESDSLFPLTPDTKAHDTRAEKSPL
SLRFNSLGTKPAIKHDISPAKKKRNIKNKPSKRARTGSSKEATVPTQHTITKFFSKLVCP
DPGADKLVNVCAKSDEENIMSQMDCPSPYKEELEQFMQIVDGSPSLRNYASHILDKSKGD
ISKALDIYYSDRDCSLDENKGKLTESSKSGTVQNHTGCCSSVQAPKETENLLKMDDVSAV
IQPLNKAVSLVPEKDKVHISPREQPTDVASCLVSLPPQDYSPIEHACWKGGQPAPYLHLA
RTFDLVEEEKGKIKATLMLCNMFRSLLALSPEDVLPAVYLCTNKIAPDHENMELNIGGSI
IVSALEETCGANKSKIRTMYNNLGDLGDVAQLCRQTQSLLATPAPLSIRGVFQALHKISI
QTGNGSTSRKKGLIMNLMRSCREKEMKYLVRTLVRNLRIGAMMRTVLPALAQAVAMSSSP
AERSTENTKQQYQALSAVVLEAYNVLPNLDLLIPSLMDHGIKFSSTTLSMVPGTPIKPML
AKITNGIPQVLKLFSCKAFSCEYKYDGQRAQIHKLGDGSVRVFSRNGDETTSRFPDLVNI
IKESCSSEASSFVLDAEVVAVDRKNGCKLMSFQELSSRERGGKDSLIAVDNIKVDICVFA
FDIMFANGEQLLSIPLRQRQTYLKKLFGNERAGYFEYARGLIVEADDAVMTNDETLTKMN
SFLDDALRSSCEGIMVKSLDVEAGYTPSKRSDTWLKVKRDYVEGLNDTLDLVPIGAWHGN
GRKAGWYSPFLVACYNPDLEEFQSVCRVMSGFSDPFYIEMKEFYSEDKILDKKPPYYQTG
EKPDMWFNPELVWEIRGAEFSISPVHHAAIGLVHPSRGLSIRFPRFVRSRPDRKPEECST
AMDIAEMFNSQTRKMDVNVAE
NT seq 4206 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaaaccctaaccctagactcctcatctctcttcctcaattcactcaattcc
actccatcacccctcactccattccccacagacttcccccaatcaaaacgcatccccaat
tcacgtttcatcgtcgatggcttccgacacgccggcgatcactccgtttcctacttcctc
tcccacttccactccgatcactacaccggcctctctcccaattggtccaaaggcatcatc
tactgctctcaaatcaccgctcgtcttctcgtcgaagtgctgaaagttccggctgctttc
gtagtctcgttgccgatgtccgagattgtcgtggtggatgattgtgaagtgaggctggtg
gatgctaatcactgtcccggtgctgtgcagtttttgtttaaggttagggtttcggatggc
ggattcgagaggtatgtgcatactggcgattttcggtattgtgatgatatgaaattagac
gatgcgctgtgtgaatttgttggtgctgatgttgtttatttggatactacatattgtaat
ccgaagtttgtgtttccggtgcaagatgagtctgttgattatattgttgaggctattaat
aggattggtgtggagaatgtggacaagtcgaagtcagttttgtttcttgttgctacttat
gttatcgggaaggagaggattttggttgagattgcgaggaggtgtaataggaaaatacat
gttgataggaggaaaatggatattttgggggttttggggtttggcgaggatgaggtgttt
acggaggatgaatcagagagtgatgttcatgttgttggctggaatgtgttgggtgagact
tggccgtattttcggcctaattttgtaatgatgaatgagattatggctgccaaagggtat
agtaaggtagttggttttgtaccgactggttggacgtatgaagtgaaacgtaataaattt
gctgttaggacaaaggactcgtttgagatacatcttgtaccgtatagtgaacattcaaat
tatgaagagcttagagaatatgtgaagttcttgaaacccaagcgtgttattcccactgtt
ggagtagatgtggagaaacttgacagcaagcatgctcttgcaatgcagaagcattttgct
ggcttggttgatgaaatggccgtcaagcaagatttcctaaagagtttccataggggggca
aggaattcaagtgataagccgacaaatgttaatacagctgggattgaagagaaagattta
gcttctgatgaagtccagactttcgagaatattgattctgaacttcatgatcaagctcct
gttccacaggatattttactagtaaatgataatgatatagaggaattggtacaagaactt
catgattgccttcctgcttgggttacacgagatcagatgttggatctgcttcagagttcc
aataaagatgttgtcgaagcagtttcttacttttacgaacacgaaatcgagtttcatgag
caggctgctgctagtacatcatctctctgtaaatctcagccaggttctgaatccgactct
ttgttccctttgacccctgataccaaggcacatgacactagagctgagaagagtcctttg
agcctgagattcaattcacttggtacaaaacctgcaattaagcatgacatttctcctgcc
aaaaagaaaagaaatataaaaaataaacctagtaaaagagcacggacaggttcaagtaaa
gaagctactgtaccaacacaacacacaattacaaagttcttcagtaagctcgtgtgtcca
gatcccggagctgataaacttgtaaatgtttgtgcaaaatctgatgaagaaaacattatg
tcacaaatggattgcccctcaccatacaaagaggagttggagcaatttatgcaaatagta
gatggcagtccatctttacgaaattatgcttctcacatattagataagtcaaagggagat
attagtaaggcactggacatttattatagtgatcgtgattgtagccttgacgagaataag
ggaaaattgacagagagtagcaaatcaggcacagtccagaatcacactggatgttgctct
tcggtccaagcaccgaaggagacagagaatctgctgaaaatggatgatgtatctgcagtt
atccagccattaaataaagctgtatcactagtacctgaaaaagacaaggttcatatatct
ccccgcgaacaaccaactgatgttgcttcatgtcttgtatcgttaccccctcaggattat
tcaccaatagaacatgcctgctggaaaggtggacaaccagctccatatctacatctcgca
cgaacttttgacttggtcgaggaagaaaagggaaagattaaagctacattaatgctgtgc
aatatgtttaggagtttattggctttgtctcctgaggatgttctacctgctgtttacttg
tgcacaaacaagattgctcctgatcatgaaaacatggaattaaatataggggggagtatt
attgtatcagcacttgaagagacctgtggagcaaataaatctaaaattcggacaatgtac
aataacttgggtgatcttggtgatgttgctcaactttgccgacagacacagtcattgctt
gctactcctgcgccactctcaatccgaggtgtatttcaagcgctccacaagattagtata
caaacaggtaatggaagtactagtcgaaagaaaggcctcatcatgaatcttatgaggtca
tgtagagagaaggaaatgaagtatcttgttagaaccttggttaggaatttacgtattggg
gcaatgatgagaactgttttgccagcattagctcaagctgttgctatgagctcatctcct
gctgaacgatcaactgaaaataccaaacagcaataccaggcactttctgcggtggtactt
gaagcatataatgttcttcccaatttggatttgctcattccttctcttatggaccacgga
attaaattttcgtcaacaaccttgtcaatggttccaggcacaccaatcaaacctatgctt
gcaaaaatcactaatgggatccctcaagtgttaaagctcttttcctgtaaagcattttca
tgtgaatacaaatatgatggtcagagagcacaaattcacaagttaggtgatggatccgtg
cgtgtcttttcacgaaatggggatgaaacaacatcgagatttccagatttagtaaacata
attaaggagtcttgtagctctgaggcttcaagttttgttttggatgcagaggttgttgct
gtagataggaaaaatggatgcaaacttatgtctttccaagaactttcttcccgggagaga
ggtggaaaagattccttaattgctgttgataacataaaggttgacatttgtgtctttgct
tttgatattatgtttgccaacggagagcagcttttgagcattccacttcgtcaacgacaa
acatatttgaagaaactttttggaaatgagagagctggttattttgaatatgcacgagga
ctaattgtggaagctgatgatgctgtcatgaccaatgatgagacactgactaagatgaac
tcttttcttgatgatgctctgcgttcttcttgtgaaggcattatggtcaaatctcttgat
gttgaagctggatatactccatctaagcgttctgatacttggttaaaggttaagcgagat
tacgtagaaggtttgaatgatacccttgatttagttccaattggtgcttggcatgggaat
ggaagaaaggcaggatggtacagtcccttccttgtggcatgctacaatcctgatctcgag
gaatttcagtctgtttgtcgtgtaatgtctgggttttccgatccattctacatagagatg
aaagaattttactcagaagacaagatactagacaagaaaccaccatattatcaaaccgga
gagaagcctgatatgtggttcaacccggagcttgtatgggaaataaggggtgctgagttc
agcatatcaccagttcatcatgctgctatcggcctggtccatccatcacgcggcctttcc
atccgctttcccagatttgttcgctccaggccagatagaaagccagaagagtgtagcaca
gccatggatatagctgaaatgttcaattctcaaaccagaaagatggatgttaatgttgca
gaataa

DBGET integrated database retrieval system