KEGG   Daucus carota (carrot): 108196737Help
Entry
108196737         CDS       T05350                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00010  Glycolysis / Gluconeogenesis
dcr00020  Citrate cycle (TCA cycle)
dcr00620  Pyruvate metabolism
dcr01100  Metabolic pathways
dcr01110  Biosynthesis of secondary metabolites
dcr01200  Carbon metabolism
Module
dcr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108196737
   00020 Citrate cycle (TCA cycle)
    108196737
   00620 Pyruvate metabolism
    108196737
Enzymes [BR:dcr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     108196737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 108196737
NCBI-ProteinID: XP_017219648
UniProt: A0A161X2F3
LinkDB All DBs
Position
7
AA seq 474 aa AA seqDB search
MSASLLLQATITPSISFSSSVSNSVKLSRVGFNPTRNARRVGPIQAKIREIFMPALSSTM
TEGKIVSWIKSEGDLLSKGESVVVVESDKADMDVETFYDGILAAIVVGEGETAPVGAPIG
LLAESEAEIEEAKAKAKNSGGPAKISEVPATKSEPAPVSAPVAEVSAPPADGPRKIVLTP
FAKKLAKQHKVDVNSVVGSGPFGRITPGDIEAAAGIVSKSVSVAAAPVASPVAAAAEPVK
AAGKSSFAEIPGSTVVPFTTMQAAVSKNMVESLNVPTFRVGYPVSTDALDALYEKVKPKG
VTMTALLAKAAAMALAQHPVVNSSCKDGKTFTYNSSINIAVAVAINGGLITPVLPDADKL
DLYLLSQKWKELVEKARAKTLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGA
SKPTVVADKDGFFSVKNKMLVNVTADHRVIYGADLAAFLQTFAKIIENPDSLTL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcctcattgcttctccaagctactattacgccgtcaatttccttctcatcttcg
gtgtcgaattcggttaagttgagccgggtgggtttcaacccgacccgaaatgcgcgccgg
gtcggcccgattcaggcgaagattcgggagattttcatgccggcgctcagttcgacgatg
acggaggggaagatcgtgtcttggatcaaatcggagggggatttgttgtccaagggcgag
tcggtggtggtggttgagtccgataaggctgatatggatgtggagacgttttacgacggg
attttagctgccattgttgttggggagggtgagactgcccccgtcggagctccgattggg
cttctggcggagtcggaggccgagattgaggaggctaaggcgaaagcgaaaaattcggga
ggtccggcgaaaatttcggaggtccccgcgacaaaatcggagccggcgccggtgagtgct
ccggtggcggaagtgagtgctccgccggcggatggaccgaggaagattgtgttgacgccg
tttgcgaagaagttggcgaagcagcataaggtggatgtgaatagtgtggtagggagtggg
ccgtttgggaggatcacgccgggggatattgaggcggctgctggaattgtgtcaaagagt
gtgagtgttgctgcggctccggttgcgagtccagtggcagctgctgcagagccagtgaag
gcggcggggaagagtagttttgcagagattccagggtctactgtggttccatttacgaca
atgcaagctgctgtgtcgaagaatatggtagagagtttgaatgtgccgacttttagggtt
gggtatcctgtgtcgactgatgcgcttgatgcactttatgagaaggtaaaaccaaagggt
gtcaccatgactgctttgttggctaaagctgctgcaatggctttggctcagcatccggtt
gtgaattctagctgtaaagatggtaagacttttacatacaacagtagtataaatattgcc
gttgctgtggcaattaatgggggtttgatcactcctgttcttccggatgctgataagctg
gatctttatttattatcacaaaaatggaaggagcttgttgagaaagcccgagcgaagact
cttcagccccatgagtataattcagggacatttaccctgtccaatttgggtatgttcgga
gttgacaggtttgatgctatccttcctcctggccagggggctattatggccgttggagca
tctaagcctactgtcgtggccgacaaagatggattcttcagtgttaaaaacaaaatgctg
gtgaatgttactgcagatcacagagtcatctatggtgctgacttggctgcgttcctccaa
acctttgcaaagattattgagaacccagatagcctgacattgtag

DBGET integrated database retrieval system