KEGG   Daucus carota (carrot): 108200536Help
Entry
108200536         CDS       T05350                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108200536
Enzymes [BR:dcr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     108200536
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 108200536
NCBI-ProteinID: XP_017224219
UniProt: A0A175YJH3
LinkDB All DBs
Position
9
AA seq 152 aa AA seqDB search
MAKGVAVLSSSAGVSGTIYFTQEGDGPTTVTGNVSGLAPGPHGFHVHALGDTTNGCMSTG
PHYNPAGKEHGAPEDENRHAGDLGNVTVGEDGTASFTIVDKQIPLTGSGSIIGRAVVVHA
DPDDLGKGGHELSKSTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagggtgttgcagttcttagcagcagtgctggagtcagtggcaccatttacttc
actcaggaaggagatggtccgactacagttactggaaacgtttctggtcttgcacccgga
cctcatggtttccatgtccatgcacttggtgatacaacaaacggatgcatgtcaactgga
ccccactacaaccctgctggtaaagagcatggagcccctgaagatgagaaccgtcatgct
ggtgaccttgggaatgtgacagttggtgaagatggtactgccagtttcaccattgttgac
aagcagattcctcttactggatcaggctccatcattggaagggcagttgtcgtccatgct
gaccccgatgacttgggaaagggtggtcatgaactcagcaaaagcactggaaatgctggt
ggaagggttgcctgcggtataattggtctgcaaggttga

DBGET integrated database retrieval system