KEGG   Daucus carota (carrot): 108204487Help
Entry
108204487         CDS       T05350                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00250  Alanine, aspartate and glutamate metabolism
dcr00410  beta-Alanine metabolism
dcr00430  Taurine and hypotaurine metabolism
dcr00650  Butanoate metabolism
dcr01100  Metabolic pathways
dcr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    108204487
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108204487
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108204487
   00430 Taurine and hypotaurine metabolism
    108204487
Enzymes [BR:dcr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     108204487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 108204487
NCBI-ProteinID: XP_017229443
UniProt: A0A166I517
LinkDB All DBs
Position
1
AA seq 496 aa AA seqDB search
MVLSSTFLESDSSIRSTFGSRYAITSLPRFKISENSIPKEAAYQIIKDELMLDGNPRLNL
ASFVTTWMEPECDKLIMDSINKNYVDMDEYPVTTELQNRCVNIIANMFNAPLEEGETAVG
VGTVGSSEAIMLAGLAFKRNWQNKMKALGKPHDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPEKAAEMVDENTICVAAILGSTLNGEFEDVKLLNDLLVKKNAETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKADLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYKNIMENCQENAMVLKRGLEK
TGKFNIISKDIGVPLVAFSLKNHSLHNEFEVSDMLRRYGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVTNIEQVLEELDTLPSKVTQKLTTEEDVENGKVVKKTALEVQREITT
AWKKLVADKKKTKGVC
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggttctctccagcactttccttgaatccgattcttcgatcaggtccacattcggatcc
cgctacgccatcacctcccttccgaggttcaagatatcggagaattcgataccgaaagaa
gcagcgtatcagatcataaaagatgagctgatgctggacgggaatcctcggctgaacttg
gcctcattcgtgacgacgtggatggaaccggagtgtgataagctgatcatggactccatt
aacaagaactacgttgacatggatgagtaccctgtcactaccgagttgcagaatcgatgt
gtgaacataatagcaaatatgttcaatgcacctcttgaagaaggagaaactgcagttgga
gttgggacggttggatcttcagaggctataatgctggctggtttagcattcaagagaaac
tggcagaataagatgaaagctcttggcaaaccacacgacaaacccaacattgtcactggt
gctaatgttcaggtgtgttgggagaaatttgcaaggtattttgaagtggagctgaaggag
gtcaagttgagagacggctactatgtgatggaccctgaaaaggctgcagaaatggtggat
gagaacaccatttgtgttgcagctattctaggatccactcttaatggagaatttgaagat
gttaagctcttaaatgacctcttggttaagaaaaatgcagaaaccggatgggatacacca
attcatgtggacgctgctagcggcgggttcattgccccatttctttacccggaattggaa
tgggacttcaggttgccactagtgaagagtatcaacgttagtggccacaagtacggactt
gtatatgctggaattggctgggtgatttggaggaacaaagccgacttgcctgaagaactt
attttccacatcaactatcttggagctgatcaacctacctttaccctcaacttttctaaa
ggttctagtcaagtgattgctcaatactatcaacttattcgcctaggttttgagggatac
aaaaatatcatggagaactgtcaagaaaatgcgatggtacttaagagaggactggagaaa
acagggaaattcaacatcatctcaaaagatattggagtcccactagtcgcattctctctg
aagaatcatagcctacacaacgaattcgaagtctcagacatgttaaggcgttatggttgg
attgtgccagcttacaccatgcctcctgatgcccaacatgttactgtccttcgtgtagtt
atccgcgaggacttctcaaggactctggctgaacgtctggttacaaatatcgagcaggtc
cttgaggagcttgacacgctcccaagcaaggtgacacagaagttgacaactgaggaagat
gtggagaacggcaaggttgtgaagaaaactgctctggaggtacaaagggaaattacaaca
gcctggaagaagctcgtcgcggataagaagaaaactaagggagtgtgttaa

DBGET integrated database retrieval system