KEGG   Daucus carota (carrot): 108205405Help
Entry
108205405         CDS       T05350                                 

Definition
(RefSeq) alpha-glucosidase-like isoform X1
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00052  Galactose metabolism
dcr00500  Starch and sucrose metabolism
dcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108205405
   00500 Starch and sucrose metabolism
    108205405
Enzymes [BR:dcr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108205405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 108205405
NCBI-ProteinID: XP_017230836
LinkDB All DBs
Position
1
AA seq 904 aa AA seqDB search
MNTNNKRPNPANHTHISIFILVSFIHLALPTLVSALKVEPLVGYGYKIGSSTVNPGSSLT
CDLQLINKSSVFGSDIQNLKLVASFETKDRLRIKITDANQQRWEVPQQVLHRNAPSSQES
HSTSSKKKGYTLSSPASDLIFTLHKTTPFGFSITRRSSGDTLFDTSPDLSKANTTFLIYK
DQFLQLSSALPADRSFLYGLGEHTKRSFLIEHNQTLTMWNADIASANIDLNLYGSHPFYV
DVRSPDSAGKVAAGISHGVLLLNSNGMDIEYTGDRITYKVIGGILDLYFFAGESPENVID
QYTELIGRPAPMPYWSFGFHQCRYGYVDVNDLEGVVAGYAKSRIPLEVMWTDIDYMDGYK
DFTFDPNNFPLDKMRKFVETIHSNGQKYVVIVDPGISTNSTYDTFIRGMKADIFIKRDGK
PYLGNVWPGSVFYPDFLNPRAGIFWSDEVKLFRDLLPVDGIWIDMNELSNFISSTPLPNS
ALDNPPYKINNSGFDRPINEKTVAATAIHFGNITEYNSHNLYGYLESKATNEALVKATGK
RPFVLSRSTFVGSGNHTAHWTGDNAATWDDLAYTIPSILSFGIFGVPMVGADICGFSKNT
TEELCQRWIQLGAFYPFARDHSDKFTIRQELYLWDSVAATARKVLGLRMRLLPYFYTLMY
EAHMKGAPIARPLFFSFPQNIATYRINTQFLVGKGVMVSPVLNSGAVTVDAYFPAGNWFS
LFNYSKSVSVDTGKYIRLDAPRDHINVHIREGNILAMQQEAMTTRAARKTPFELLVINST
GNSSGEVFLDDGEEVEMGGKSRMWSFIKFSFNIKGKTAIIKSEVVNGEYALSQKWIINKV
TILGLKKRVNSLYNNEFYSGITRKRLLRNTTRRQIADDTNGFVTMEISNLSLLIGKEIKL
EVTL
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaacaacaagagaccaaaccctgcaaatcacacacacattagtatcttcatt
cttgtcagtttcattcacttggctttaccaacgttagtatctgcattgaaagttgagcca
ctggttggatatgggtacaagatcgggtcgtcgacggttaatcctggatcatcattgact
tgtgatcttcagctcatcaacaagtcctctgtttttggatcagacattcagaatctcaag
cttgttgccagctttgaaacaaaagatcgcctaagaatcaagatcactgatgccaaccag
cagaggtgggaagttccacaacaagtcctccaccgcaatgcaccctcctcccaggaaagc
cactccacctcgtcgaaaaagaagggctacactctgtccagccccgcctctgacctcatt
ttcaccctccacaagaccaccccctttggcttctccattactcgtcggtcctctggtgat
accctcttcgacacctcaccagacctctcaaaagccaacaccacattcctcatttacaaa
gaccagtttctccaactctcctcagctctccctgctgacaggtcatttctttatggcctt
ggagagcataccaagagatcattcttgattgaacacaatcaaactcttacaatgtggaat
gctgacattgccagtgcaaatattgatcttaatttatatggttcccatccattttatgtg
gatgtccggtctccagactctgctggaaaagtggctgctgggattagtcatggggtcttg
ctgcttaatagtaatgggatggatattgagtacactggtgataggattacttataaagtg
attggtggaatacttgatttgtatttttttgcgggagagtccccggaaaatgtgattgat
caatacactgagctcattggccggcctgctcccatgccctattggtcatttggatttcac
caatgccgctatggctatgttgatgtgaatgaccttgagggtgtagttgctggttacgca
aagagtagaatcccacttgaagtgatgtggacagatatagactacatggatggctataaa
gatttcactttcgatcctaataactttcctctagacaaaatgagaaaattcgtcgaaaca
attcacagcaatggtcagaaatatgtggtcatcgtggatcctggaatcagcaccaactca
acttatgataccttcataagaggtatgaaagctgacatatttataaaacgtgatggtaag
ccttacctagggaatgtatggccaggttcggtattttatcctgattttcttaatccgcgt
gctggaatcttctggtctgatgaagttaagctattccgggatcttctacctgttgatggc
atatggatagacatgaacgagctatccaatttcatatcatctactccccttccaaattct
gcccttgataatcccccttacaagatcaataactcgggatttgataggcccattaatgag
aaaacagttgctgcaacggccatacattttggtaatatcaccgaatataattcacataac
ctttatggatatttggaatccaaagctactaatgaagctttggtcaaagcaactgggaaa
aggccgtttgttcttagtaggtcaacttttgtgggttctggtaatcacacagctcactgg
accggagataatgctgccacctgggatgatttagcatacacaattccgagcattttaagt
tttggcatttttggagttccaatggttggggctgatatctgtggtttttctaagaacaca
accgaggagctttgtcagcgttggattcagttaggagccttttatccttttgcacgagac
cattctgataagttcactatacgtcaagagctatatctatgggattcagttgctgcaaca
gccaggaaagtgctgggcctacgtatgagattattaccatacttttacacactaatgtac
gaggcacacatgaaaggggcccctatagcacgaccactgttcttctcattccctcaaaat
attgcaacttacagaatcaatacacagttccttgtcggtaaaggtgtgatggtgtcccct
gtgctgaactctggcgctgtcacagttgatgcatacttcccagcaggaaactggttcagc
ctcttcaactattcaaagtcggtgagtgtagacactgggaagtacatcaggctagatgca
ccccgtgatcacataaatgtgcacatccgagaaggaaacatactggccatgcagcaagaa
gctatgacaactcgcgctgctagaaagacaccattcgagctattggtgattaacagcact
ggaaacagttctggcgaagttttcttggatgacggagaggaagttgaaatgggaggaaaa
agcaggatgtggagttttataaaattttcttttaacataaagggaaaaacagcaataatc
aaatcagaggtggtgaatggagagtatgctctgagtcagaagtggatcataaacaaggta
actatactggggctgaagaaaagggttaatagcttgtataacaacgagttctatagcggc
attaccagaaaaaggctgctcagaaacacaacaagaagacagattgcagatgacactaat
ggatttgttacaatggagatctcaaatctatcactactcattgggaaagagatcaagttg
gaggttacactttga

DBGET integrated database retrieval system