KEGG   Daucus carota (carrot): 108210226Help
Entry
108210226         CDS       T05350                                 

Definition
(RefSeq) glutamate--glyoxylate aminotransferase 2
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00220  Arginine biosynthesis
dcr00250  Alanine, aspartate and glutamate metabolism
dcr00260  Glycine, serine and threonine metabolism
dcr00630  Glyoxylate and dicarboxylate metabolism
dcr00710  Carbon fixation in photosynthetic organisms
dcr01100  Metabolic pathways
dcr01110  Biosynthesis of secondary metabolites
dcr01200  Carbon metabolism
dcr01210  2-Oxocarboxylic acid metabolism
dcr01230  Biosynthesis of amino acids
Module
dcr_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    108210226
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    108210226
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108210226
   00260 Glycine, serine and threonine metabolism
    108210226
   00220 Arginine biosynthesis
    108210226
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dcr01007]
    108210226
Enzymes [BR:dcr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     108210226
    2.6.1.4  glycine transaminase
     108210226
    2.6.1.44  alanine---glyoxylate transaminase
     108210226
Amino acid related enzymes [BR:dcr01007]
 Aminotransferase (transaminase)
  Class I
   108210226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 108210226
NCBI-ProteinID: XP_017237013
UniProt: A0A166E8D0
LinkDB All DBs
Position
2
AA seq 479 aa AA seqDB search
MAALDYESINENVKKAQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPRQV
VALCQAPFLLDDPNVGLIFPADAIARAKYYLGLTSGGLGAYSDSRGLPGIRKEVAEFIEK
RDGYPSDPELIYLTDGASKGVMQILQTIIRGQGDGILVPVPQYPLYSAAITLFGGSLVPY
YLEETANWGLDIQNLRESVAESRARGITVRAMVIINPGNPTGQCLSVANLKEILKFCNQE
KLVLLGDEVYQQNVYQDERPFISARKVLMDMGPPISKEVQLVSFHTVSKGYWGECGQRGG
YLEMTNIPPQTVDEIYKVASISLSPNVPGQIFMGVMVNPPKPGDISYDRFARESKGILGS
LRKRAQIMTDGFNSCRNVVCNFTEGAMYSFPQVRLPPKAIEAAKKAGKVPDVFYCLRLLE
ATGISTVPGSGFGQKDGVFHLRTTILPAEEDMPAIMSSFKKFNDEFMEQYEDNRGYSRM
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggcagctctggattatgagtccattaatgaaaatgtgaagaaggctcagtatgctgtt
agaggtgagctgtatcttcgagcgtcagagcttcagaaggaaggaaagaagattatcttc
acgaatgtggggaatccacatgctttaggacagaagcctctaacttttccccgccaggtt
gttgctctttgtcaagcaccatttctactcgatgatcctaatgtaggacttatatttcct
gccgatgccattgcaagagccaaatattatctaggactcacctcgggtggtctaggtgcg
tacagcgactcacggggtcttcctggaataagaaaagaagtggcagagttcatcgagaag
cgtgatggatatccaagtgatccagagcttatatatctcactgatggtgctagcaaagga
gtgatgcagatcttgcaaacgataatccgaggtcaaggggacgggatattagttcctgtt
ccacaatatcctctttattcagctgccattactttatttggtggttctcttgttccatac
tacttggaggagacagctaactggggtcttgatatacaaaaccttcgcgagtcagttgca
gaatctcgtgctagaggaataacagtacgagctatggtgattataaatcccggaaatcct
actggacagtgccttagtgtagccaatttgaaagaaatactgaagttctgcaaccaagag
aaactggtcctgcttggagatgaagtttatcagcaaaatgtttaccaagatgaacgtccc
tttattagtgcaagaaaggttttgatggacatgggcccaccaataagtaaagaggtccag
cttgtctcctttcatacagtgtccaaaggctattggggagaatgtggacagcgaggaggc
taccttgagatgactaacattcctccacagactgttgatgaaatatacaaggtcgcatcg
atttcgctaagtccaaatgtccctggacagatattcatgggtgtgatggtcaatcctccc
aaacctggagacatctcatacgataggtttgctagagagagcaaaggtatccttgggtca
ctgaggaagagagcacaaataatgacagatggattcaacagctgcagaaatgtggtttgc
aattttactgaaggtgccatgtattccttcccacaagtacgtttacctccaaaagcaatt
gaggctgcaaaaaaagctggaaaagttcctgatgttttctactgcctcaggctgttagag
gccacaggcatctccacagtcccaggttcagggtttggacaaaaggacggggtgttccat
ttgaggacaaccatcttgcctgctgaagaggacatgcctgcaatcatgtccagttttaag
aaatttaatgacgagttcatggagcaatacgaagacaacagaggctattcaaggatgtaa

DBGET integrated database retrieval system