KEGG   Daucus carota (carrot): 108214958Help
Entry
108214958         CDS       T05350                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108214958
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dcr03036]
    108214958
Enzymes [BR:dcr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108214958
Chromosome and associated proteins [BR:dcr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108214958
   Polycomb group proteins
    PRC2-EZH2 complex
     108214958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 108214958
NCBI-ProteinID: XP_017242720
LinkDB All DBs
Position
3
AA seq 942 aa AA seqDB search
MAPPNTIDLHIPSESMPPAMSPSDSSSGTRSDSPPPSQGLQERGLAASKVSLVINSVKKR
LFAQRCVHVKMRMEENKQKMADLTNNLLTSAQERGYLRGDESNANIDLLSKRQKYAVDMH
NGIEKNNGDDDNNTSQDDGYGSVILLGSSIAVKNAVRPIKLTEVKKLPTYTTWVFLDRNQ
RMTEDQSVFGRRRIYYDQSGGEALIASDSDEEVVDEFEEKKEFKDSEDYILRETINEVGL
SDAVLDSLAQCFSKQPSEVKARYEALVKRETLATSADSNILLSEEIPSSYLDKDLDAALD
SFDNLFCRRCLVFDCRLHGCSQDLIFPAEKQLPWTCPETESKPCGPHCYRVALESERKAT
VNSPVRVVGKDLGLPCTDVSGSQLSRGLSAGVSLRRRSKSVQSESATSNGINVSESSDSE
SKRRRDVTATRTSLSPSNTKLVEKREVHKRNSSRLAEHVINMRKKQKKMVTTSDSDSLAS
ASPGSGDTNTHSILRKENEDASSCSQKFISSNTRRSTRKGSPALNGDRLLQHKVIDSLST
GMNSGQPLPSSDNTLKKGEFVDESSCKEVIDVTSWKTVEKALFAKGVEIFGRNSCLIARN
AMNGLKTCSEVFHYMNHSENKLSSEEGNGLNPLAEGSSKGDGNENMGTQLRRRSKYLHRR
GRVRRLKYTWKSSGSHSYRKRISDAKDQPCRQYNPCGCQSACGKDCSCYLNGTCCEKYCG
CPRTCKHRFRGCHCAKSQCRSRQCPCFAASRECDPDVCRNCWISCGDGTLGIPWQRGDNY
ECRNMKLLLKQQQRVLLGRSDVSGWGAFLKKSVVKHDYLGEYTGELISHREADKRGKIYD
RVNHSFLFNLNDQYVLDAYRKGDKLKFANHSPEPNCYAKVMMVAGDHRVGIFAKEKICAG
EELFYDYRYEADRAPEWAKKPESSGTKKDDHTPSNGRAKKIA
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcctaatacaattgaccttcacattccgtccgaatctatgccgccggcaatg
tcgccgtccgactcttcctccggtaccagatcagattctcctccaccgagccagggactg
caagaaagaggtttggcagcttctaaagtttctctagttatcaattctgtaaagaaacgg
ctttttgcgcaaagatgtgtccatgtaaagatgagaatggaagaaaataaacagaagatg
gctgatctcaccaacaatttgctaacgtctgcacaagaaagaggatacctcaggggtgat
gagagtaatgctaacattgatctactatcaaagaggcagaaatatgcagttgatatgcac
aacggaatagagaaaaataacggggatgatgacaacaatacttctcaagatgatggatat
ggatctgtaattcttttaggatctagtatagcagtaaagaatgctgttcgtcccatcaag
ctcacagaagttaagaaattaccaacatacaccacttgggttttcttagacagaaaccag
agaatgacagaagatcaatctgttttcggtagaagaagaatttattatgatcaaagtgga
ggtgaagcgcttatcgctagtgacagtgatgaagaagttgttgatgaattcgaggaaaag
aaagaatttaaggattctgaagattacatacttagagagacaatcaacgaggttggctta
tctgatgctgttttggattcactggcacagtgtttttctaaacaaccttctgaagtcaag
gcaagatatgaagctcttgtgaagagggaaacccttgctactagtgcagactcaaacatt
ttactcagtgaagagattccaagttcatatcttgataaagatcttgatgctgctttggat
tcatttgacaatctattttgccgtcgatgtcttgtctttgactgtagattgcatgggtgt
tcacaggatcttatctttcctgctgagaaacaacttccatggacctgtccagaaacggaa
agcaagccatgtggtcctcattgttatcgcgtggccttagagtcagaacgtaaagctaca
gtgaattctcctgtgagggtggttggcaaagatttaggtttaccatgtactgatgtttct
ggctctcaactatcaagaggactatctgctggtgtatctttaaggaggaggtctaagtct
gtccaaagtgaaagtgctacatcaaatggaataaatgtatcagaaagcagcgactcagaa
agtaaacgtcgacgggacgtcactgctactcgcacttcactatcaccatcaaacactaag
cttgttgagaagcgtgaggttcataagagaaatagcagcagattagctgagcatgttatt
aatatgagaaaaaagcagaaaaaaatggtgacaacttcagattctgattctcttgctagt
gctagtcctggttctggcgatacaaatacccattccatcttgcgaaaagagaacgaagat
gctagttcttgttcacaaaaatttatatcttcaaatactagacgatctacaaggaaaggt
tcgccagctctaaatggtgataggttactccagcataaagttattgactctctcagtact
ggaatgaatagtggtcaacctctgcctagcagtgataacaccttgaagaaaggggaattc
gtggatgagagcagttgtaaagaagtcattgatgttacatcatggaaaactgtagaaaag
gctctatttgccaaaggtgtggaaatatttggcaggaacagctgtttgatagcaaggaat
gctatgaatggattaaagacatgttcagaggtgtttcactatatgaatcactctgagaac
aagctatcctctgaagaaggcaatggtttaaatcctctggctgagggctcttctaagggc
gatggcaatgaaaatatgggtactcaattaagaagaagatcaaaatacctacataggaga
ggtagagttcggcgcttgaagtacacatggaagtcttctggtagccattcatataggaaa
cgtatttcggatgcgaaagatcaaccttgtcgacaatataatccatgtgggtgtcagtct
gcttgcgggaaggactgttcttgttatttgaatggaacctgttgcgagaagtactgtgga
tgtccaaggacttgcaaacaccgattcagaggctgtcactgtgccaaaagtcaatgtcga
agtagacagtgtccatgttttgctgccagtagggaatgtgatcctgatgtttgccgaaat
tgctggatcagttgtggagatggtactcttggcatcccctggcaacgaggtgataattat
gaatgcaggaacatgaagcttcttctaaagcaacagcaaagggtgttacttggaagatct
gatgtatctggttggggagctttcttgaagaaaagtgttgttaaacatgattatcttgga
gagtacaccggggaactgatctcacaccgggaagctgacaaacgtggcaaaatatatgac
cgtgtaaatcactcatttctgttcaacctgaatgatcagtacgtgcttgatgcttatagg
aaaggggataaattgaaatttgcaaatcattcgccagaacccaactgctatgcaaaggtt
atgatggtggctggtgatcatagggttggtatatttgcaaaggaaaagatttgtgctgga
gaagaactattttatgactatcggtacgaggcagatagagcacctgaatgggccaaaaaa
ccagagtcctctggtaccaaaaaagatgaccataccccttcaaatggccgagctaaaaag
atcgcttga

DBGET integrated database retrieval system