KEGG   Daucus carota (carrot): 108216133Help
Entry
108216133         CDS       T05350                                 

Definition
(RefSeq) nitrilase-like protein 2
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
dcr  Daucus carota (carrot)
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108216133
Enzymes [BR:dcr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     108216133
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 108216133
NCBI-ProteinID: XP_017244301
LinkDB All DBs
Position
4
AA seq 282 aa AA seqDB search
MTSSVRVAAAQMTSINDLAANFSTCSRLVKEAASAGAKMLCFPENFSYVGAALGDSLKIA
EPLDGPIMKGYCSLARESNIWLSLGGFQEKGSDDAHLRNTHVLIDNAGNIKSTYSKMHLF
DVDVPGGAVYKESSFTEAGKEIVAVDSPVGRLGLTVCYDLRFPEIYQQLRFHHEAQVMLV
PSAFTKVTGEAHWEILLRARAIETQCYVIAAAQAGKHSEKRESFGETLIIDPWGSVIGRL
PDRVSTGLAVADIDFSLLDSVREKMPISKHRMSLDFWKQVST
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgacgagttccgtccgagttgcggcagctcagatgacttcaatcaacgacctcgccgcc
aatttctccacttgttctcgccttgtcaaggaagcagcttcggctggggcaaaaatgctt
tgttttcctgaaaacttctcctatgttggcgctgcacttggtgatagtcttaagattgca
gaaccactagacgggcctatcatgaaagggtactgttctcttgcaagggaatccaacatt
tggttgtctctgggaggattccaagaaaaaggatcagatgatgcacacttgcgtaacaca
catgttttaattgacaatgctggaaatatcaaaagcacatatagcaagatgcacttgttt
gatgtggatgttcctggaggggctgtgtataaagagagcagctttacagaagcagggaag
gaaattgtagcagtagacagccccgtcggacggttgggtttgacagtttgttatgattta
agattcccagagatctatcagcagctgaggtttcatcatgaagcacaggtgatgttggta
ccttcagcatttacaaaagttacgggggaggcccactgggagattcttctccgtgcccgt
gcaattgaaacccagtgctatgtcatagcagctgcacaagcaggaaagcatagtgaaaaa
agagaaagctttggtgaaacactaataattgatccttggggttctgtcattggtcggcta
cctgatcgagtgtcaacaggccttgctgttgcagatattgacttctcactgcttgattca
gttagagaaaagatgccgatttccaagcaccggatgtcccttgatttttggaaacaggtc
tctacgtaa

DBGET integrated database retrieval system