KEGG   Daucus carota (carrot): 108223418Help
Entry
108223418         CDS       T05350                                 

Definition
(RefSeq) beta-galactosidase 17
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00052  Galactose metabolism
dcr00511  Other glycan degradation
dcr00531  Glycosaminoglycan degradation
dcr00600  Sphingolipid metabolism
dcr00604  Glycosphingolipid biosynthesis - ganglio series
dcr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dcr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    108223418
  Lipid metabolism
   00600 Sphingolipid metabolism
    108223418
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    108223418
   00604 Glycosphingolipid biosynthesis - ganglio series
    108223418
   00511 Other glycan degradation
    108223418
Enzymes [BR:dcr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     108223418
Exosome [BR:dcr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108223418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 108223418
NCBI-ProteinID: XP_017253171
LinkDB All DBs
Position
5
AA seq 675 aa AA seqDB search
MAILHIHFKFTTITWIFFFFSSLSCSTSHLLHNAHTRKFEIADDMFWKDGKPFRIIGGDL
HYFRVLPEYWEDRLLRAKALGLNAIQTYVPWNLHEPRQGQLVFEGIADLVAFLKLCQKLD
FVVMLRAGPYICGEWDLGGFPAWLLSIEPAVRLRSSDPAFLHLVDNWWGILLPKMAPLLY
SNGGPIVMVQIENEFGSYGDDKSYLHHLVKLARSHLGEELTLYTTDGGSRETLQKGTIRG
DAVYSAVDFTTGDDPWPIFELQKEFNAPGKSPPLSAEFYTGWLTHWGENIAHTDAKSTAA
ALGKILEKNGSAVLYMAHGGTNFGFYNGANTGEGESDYKPDLTSYDYDAPISEFGDVDNA
KYKALRRVIEKYSAVSLPPLPRNNKKTGYGNFRLQRTAFLFDMLNKTDHADILKSDDPVS
MEVFGEMFGLVLYASEYIHKGKKSILSIPKVHDRAQVFVSCSTKNKQARPKYAGTIERWS
NQAIRLPNLSCTSPIKLLILVENMGRVNYGPYMFDRKGILSSVYLDGQPIHKWKMLSVPF
QKIPEVKKISPILKDALSDNIKISSHRKLKINLDSISKQPAFYVGSFAVGEVHDSFISFT
GWGKGIAFVNGFNIGRYWPTKGPQCNLYVPAPVLHRGQNVVVILELESPNPDLLLSSVDD
PDFTCGTKSSKVHQL
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggcgattttgcatattcactttaaattcactacaataacctggatcttcttctttttc
tcatctctctcctgctccacttcacacctgctgcataatgctcatactcgaaaatttgag
attgctgatgatatgttctggaaagatggcaagccttttcgaatcatcgggggtgatctt
cactattttcgtgttcttcctgagtactgggaagatagactcttgcgggcaaaggcattg
ggtttaaatgctattcaaacttatgttccttggaatttgcatgaaccaaggcaaggccaa
cttgtttttgagggtattgcagatttagtcgcatttctaaaactgtgccagaagctggat
tttgtggttatgcttcgagctgggccttacatatgcggagaatgggatttgggtggtttc
ccagcttggttactttcaatcgaaccagctgtgagacttagatcatcagacccggctttc
cttcatttggttgataattggtggggtatcttactccccaaaatggctcctcttctctat
agcaatggaggtcctatagtaatggttcagatagaaaatgaatttggttcgtatggagat
gacaaatcatacttgcatcatctggtaaagttagccagatcacaccttggagaagagcta
acattgtataccactgatggaggttctagggaaactcttcagaaaggaacaattcgtggc
gatgctgtttattcagctgttgactttacaactggagatgatccatggcctatattcgag
ttgcaaaaggagtttaatgcacccgggaaatcaccccctctttctgcggaattctacact
ggttggcttactcattggggagagaatattgcacacacagacgcaaagtctacagcagct
gctcttggaaaaatattggaaaaaaatgggtctgctgttctttatatggcacatggtggc
acaaactttggattctataatggtgcaaataccggcgagggagagtctgattacaagcct
gatcttacatcctatgattatgatgcacccatttcagagtttggtgatgtggataatgca
aaatataaagcattgcggagggtgattgaaaaatatagtgcagtatccctccctcccctc
ccacgcaataacaaaaagactggatatgggaatttcaggctgcagagaactgcatttttg
ttcgatatgcttaacaaaacagaccatgcagatatcttaaaatctgatgatccggtttca
atggaagtctttggagagatgtttggactggtactatatgcatctgagtacattcataaa
ggcaaaaaaagtattttatccataccaaaggtgcacgacagagctcaagtgtttgtctca
tgctctaccaaaaataagcaagctagaccaaaatatgccgggacaattgagagatggtcg
aatcaagctataagacttccgaatctcagttgcacttcccccatcaaactactaatcctg
gttgaaaacatgggtcgtgtaaattatgggccatatatgtttgacaggaagggtattctt
tcctccgtttatctcgatggacaacctatccataagtggaaaatgctatcagtgcctttc
cagaaaataccagaagtcaagaagataagtccaatcttgaaggatgcactgtctgacaat
atcaaaatatctagccacagaaaactgaaaattaacttagactcaatctcaaaacagcca
gcattctatgttggtagttttgctgttggagaagttcatgattctttcatatcatttact
ggctggggtaaaggaattgcgtttgtcaatgggttcaatattggcagatattggccaaca
aagggaccacaatgtaacctttatgttcctgctccagtcctgcaccgtggccaaaatgtt
gtggtcatacttgaactggaatctccaaatcctgatcttctgctgagctcggttgatgat
ccagatttcacatgtggtacaaaaagttcaaaagtgcatcagctctaa

DBGET integrated database retrieval system