KEGG   Daucus carota (carrot): 108224093Help
Entry
108224093         CDS       T05350                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00564  Glycerophospholipid metabolism
dcr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108224093
Enzymes [BR:dcr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     108224093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 Pyr_redox_2 NAD_binding_8 GIDA Pyr_redox Pyr_redox_3 HI0933_like FAD_binding_3 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 108224093
NCBI-ProteinID: XP_017254132
UniProt: A0A164ZF94
LinkDB All DBs
Position
5
AA seq 626 aa AA seqDB search
MRLRHATVAAAVSVAAGGSYLALRSPSFSVNDRGGATAFEELRRKISDPSAVVPPRAAQV
SSLAGATATKPLDVLVIGGGATGSGVALDAVSRGLRVGLVEREDFASGTSSRSTKLIHGG
VRYLEKAVFNLDYGQLKLVFHALNERKQLIANAPHLCHALPCMTPCFSKFEVVYYWAGLK
FYDLVAGKQLLHLSRYYSAKESSELFPTLAKKGKDRTLKGTIVYYDGQMNDSRVNVAIAC
SAALAGAAVLNHAEVVSFLKEDVSGRIIGARIRNNLSGDEFDTYAKVIVNAAGPFCDGVR
NLADKDAKPIICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTDSQ
TPITMLPEPHEDEIQFILDAISDYLNVKVRRTDVLSAWSGIRPLALDPTAKNTESISRDH
VVCEEFPGLVTITGGKWTTYRGMAQDAVDAAIKAGKLKPANDSLTHDLRLVGGEGWENSS
FTELAQQYLRNKMSHGKVVPGEMDSVAARHLSHAYGTLAHRVAKIAQNENLGKRLAHGYP
YLEAEVAYCAREEYCESAVDFLARRCRLAFLDTDAAFKALPRVIQILATEHKWDKSRQSK
EVEKANEFLQTFKALKNAQFHDGKHN
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctccgtcacgccaccgtcgcggcggcggtctccgtggcggccggtggctcgtac
ctcgctctccgtagccctagcttctcggtcaatgaccgcggcggcgccaccgccttcgag
gagcttcgcaggaagatcagcgatccttccgctgttgtgccgccgcgagcggcgcaggtg
tcgtcgctcgccggagctaccgcgacgaaaccgctggatgtgcttgtgatcggcggtgga
gcgactggaagcggcgtcgctcttgatgctgtttcgagaggccttcgtgttggacttgtg
gagcgcgaggatttcgcgtccggtacgtcgtcgagatcgacgaagctcattcacggaggt
gttcgctatttggaaaaagctgtttttaatctagactatgggcaattgaagctggttttc
catgctcttaatgagcgtaaacaactaatcgcaaatgctcctcacctttgtcatgctttg
ccgtgtatgacaccatgttttagtaagtttgaggttgtttattattgggcggggttaaag
ttttatgatctagtagcaggcaagcaattgctacatctgtcaaggtattattctgcaaaa
gaatcttcagaactgtttccgactctcgcaaagaagggtaaagatagaacactgaaggga
acaattgtatattatgatggacaaatgaatgattcacgggttaatgttgcaatagcatgt
agtgctgcattagctggtgcagctgtattaaaccatgcagaagtagtatcctttcttaag
gaggatgttagcggccgaatcattggtgctcgtatccgtaacaatttatcaggtgatgag
tttgatacgtatgcgaaagtcattgtgaatgcagccgggccattttgcgatggtgtaagg
aatttggctgacaaagatgcgaaacccataatttgtcctagcagtggggtgcatatagtt
cttcctgactactattcccctgaagggatgggtttaattgttccaaaaactaaagatgga
cgtgtcgtcttcatgctcccttggttgggtagaacagttgcaggtaccacagattctcag
acccccatcactatgctaccagaaccccatgaggatgagattcagtttatactggacgcc
atctccgattacctcaatgttaaggtacggcgtacagacgttctttctgcatggagtggt
attcgccctttggcactggatcctacagcaaaaaatacagaaagtatttctcgggatcat
gtagtctgtgaagaatttcctggtttggtcaccattactggtggaaagtggacaacatat
agaggtatggcccaagatgcagttgatgctgctataaaagcaggaaaactgaaaccagcc
aatgatagtttgactcatgatctgcgccttgttggtggagaaggatgggaaaattcatct
ttcactgagcttgctcaacaatatctacgcaataaaatgtctcatggaaaagttgttcct
ggagagatggatagcgtcgcagcaaggcatttatctcatgcatatggcactttggctcat
cgagtggctaaaatagcccagaatgaaaatttagggaagcggcttgcacatggatatcct
tatttagaagccgaggttgcctattgtgctcgggaagagtactgtgaatctgcagtagat
ttccttgctcggagatgtcgtcttgcattccttgacactgatgcggcatttaaggcactg
ccacgcgtcatacagatactggctactgaacacaaatgggacaagtcaaggcagagtaaa
gaggttgagaaagccaatgaattcttgcaaaccttcaaggcactgaaaaatgcacagttc
catgatggaaaacacaactag

DBGET integrated database retrieval system