KEGG   Daucus carota (carrot): 108227406Help
Entry
108227406         CDS       T05350                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00620  Pyruvate metabolism
dcr00710  Carbon fixation in photosynthetic organisms
dcr01100  Metabolic pathways
dcr01200  Carbon metabolism
Module
dcr_M00168  CAM (Crassulacean acid metabolism), dark
dcr_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
dcr_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
dcr_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    108227406
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    108227406
Enzymes [BR:dcr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     108227406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 108227406
NCBI-ProteinID: XP_017258018
UniProt: A0A164W6E4
LinkDB All DBs
Position
6
AA seq 966 aa AA seqDB search
MASRNLEKMASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQDC
YELSAEYEGSTDPQKLEELGRMLTSLDAGDSIVVAKCFSHMLNLANLAEEVQIAYRRRIK
LKKGDLADEASATTESDIEETFKRLVGELKKTPEEVFESLKNQTVDLVLTAHPTQSVRRS
LLQKHARIRDCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTAPTPQDEMRAGM
SYFQETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANMYFSQIEDLMFELSMWRCSDELCARADELHRSSKRDAKHYIEFWKQIP
PNEPYRVILSDVRDKLYHTRERSRQILSNGVSDIPEEATFTNVEQFLEPLELCYRSLCSC
GDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVMDAITKHLEIGSYREWSEEGR
QEWLLSELSGKRPLFGHDLPKTEEIADVLDTFHVISELPSDSFGAYIISMATAPSDVLAV
ELLQRECHVKTPLRVVPLFEKLADLEAAPAAMTRLFSIDWYKDRINGKQEVMIGYSDSGK
DAGRLSAAWQLYKAQEELIQVAKQFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTVHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPISPKPEWRALLDEMAVIATK
EYRSIVFQEPRFVEYFRLATPELEYGRMNIGSRPAKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKHIIEKDIRNLQMLKEMYNEWPFFRVTIDLVEMVFAKGDPGIAALYDK
LLVSEELWPFGERLRAIFEESKSFLLQIAGHKDLLEGDPYLKQRLRLRDSYITTLNVLQA
YTLKRIRDPSYDVKVKPHLSREITESSKKPAAELLKLNPMSEYAPGLEDTLILTMKGIAA
GMQNTG
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtaggaatttggagaagatggcatcgattgatgcgcaattgaggcttttggca
cccagaaaggtgtcagaagatgacaaattggtggagtacgatgcgttgttgctcgatcga
tttctcgatattcttcaggatctgcatggcgaggacattcgcgaaacggtgcaagactgt
tatgagctctcggctgaatatgaagggagcactgaccctcagaagttggaggagcttggg
agaatgctgacaagcttggatgctggggattctattgtagttgccaagtgcttctctcac
atgcttaatttggccaatttggctgaagaggttcagatagcttacagacggaggattaaa
ctgaagaagggtgatttggcagatgaagcctctgcaacaactgaatcagatattgaagag
acatttaagaggcttgtgggtgagttgaagaagacccctgaagaagtttttgaatctttg
aagaaccagactgtggacttggtccttacagctcatcctacacagtcagttcgcagatcg
ttgcttcagaagcatgctaggattcgtgattgtttggctcagttgtatgctaaagacatc
actcctgatgataagcaggagttggatgaggccctccagagagagatacaagctgcattt
cgcactgatgaaattaggagaactgcaccaactccacaagatgagatgagagcaggaatg
agctactttcaagagaccatttggaagggagtccctaaattcttgcgtcgtgttgacacc
gccttgaagaatatcgggatcaatgaacgagttccttataatgcaccccttattcagttt
tcttcttggatgggtggtgatcgtgatggaaatcctagagtgactcctgaggtcacaagg
gatgtttgtttattggctagaatgatggctgccaatatgtacttttcccagatagaggat
cttatgtttgagttatcaatgtggaggtgcagtgatgaactttgtgctcgtgctgatgaa
cttcatagatcttctaagagagatgctaaacactatattgagttctggaaacaaatccct
ccaaatgaaccttatcgtgttattctttctgatgtgagggataaactgtatcatacccgc
gaacgttctcgtcaaatcttatcaaatggggtctctgatattcctgaagaagcaactttc
acaaatgttgagcagtttctagagcctctagagctttgttacagatcactctgttcgtgt
ggtgatcggccaattgctgatggaagccttcttgatttcttgcggcaagtttctaccttt
ggtctctctcttgtaaggcttgatattcggcaagaatccgacaggcacacggatgtgatg
gatgctattacaaagcacctggaaatcggatcctaccgggagtggtcggaggaaggcagg
caggagtggcttttatctgaactcagcggaaaacgccctctgtttggtcatgatcttccg
aaaacagaagaaattgctgatgtgttagacaccttccatgtcatctctgaactcccatca
gacagcttcggtgcctatattatttcaatggcaactgctccatctgatgtgcttgctgta
gagcttctacaaagggaatgccatgttaagactccactaagagttgtgcctttgtttgaa
aaactagctgaccttgaggctgcacctgcagctatgacacgattattctcaattgattgg
tacaaagacaggattaatgggaagcaagaagtcatgattgggtactcagattcaggcaag
gatgctggccgcctctctgcagcttggcaactatataaagctcaggaagagcttatacag
gtagcaaagcaatttggagtaaagctaacaatgtttcatggtcgtggaggcacagtcgga
cgagggggaggtcccacacatcttgctattctatctcagccaccagatacagttcatgga
tcgctacgtgtaactgtccaaggtgaagttattgaacaatcttttggtgaggagcacttg
tgctttaggacactccaaagattcactgctgctacactggagcatggaatgcatcctcct
atatcacccaagccagaatggcgtgcactcctcgatgagatggcagtcattgctacaaag
gagtatcgatccattgtttttcaggagccccgatttgtggagtacttccgccttgcaacg
ccggagctggagtatggccgtatgaatattggtagtcgtccagctaagagaaagccaagt
ggcggaatagaatctcttcgagcaatcccatggatctttgcttggacacagacaaggttt
catcttccggtttggcttggctttggagctgcatttaagcatattattgagaaggatata
cgaaatcttcaaatgctcaaggagatgtacaatgaatggcctttcttccgggtcacaatt
gatttggtggagatggtatttgcaaagggtgacccgggcattgcagcattgtatgataag
ctcctagtttcagaagagttgtggccttttggggagcgactaagagcaattttcgaagaa
tctaaaagctttctcctccagattgcagggcacaaagatctgttggaaggagatccatat
ttaaagcagagactccgtcttcgtgattcatatatcacaaccctgaatgttctccaagcc
tacacattgaaacggatccgtgaccccagttatgatgtgaaggtgaagccacatctttcg
agggaaatcacagaatcaagcaaaaagccagctgcagagcttttgaagctcaatccaatg
agcgagtacgcccctggactggaagacacccttatcttaaccatgaagggtattgctgct
gggatgcaaaataccggttaa

DBGET integrated database retrieval system