KEGG   Daucus carota (carrot): 108228123Help
Entry
108228123         CDS       T05350                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dcr  Daucus carota (carrot)
Pathway
dcr00020  Citrate cycle (TCA cycle)
dcr00190  Oxidative phosphorylation
dcr01100  Metabolic pathways
dcr01110  Biosynthesis of secondary metabolites
dcr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dcr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108228123
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    108228123
Enzymes [BR:dcr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     108228123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 108228123
NCBI-ProteinID: XP_017259098
LinkDB All DBs
Position
6
AA seq 630 aa AA seqDB search
MWRAVSRGFRIPAKRSGAGEALKPHRLFSTEARVGGSSYTIVDHTYDAVVVGAGGAGLRA
AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQ
DAIQYMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCACAADRT
GHALLHTLYGQAMKHNTQFFVEYFALDLLMASDGSCQGVIALNMEDGTLHRFQSSSTILA
TGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDQEFVQFHPTGIYGAGCLITEGSRGEG
GILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPQKDHIYLHLNHLPPEV
LKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTVKGNDPDAIVPG
LMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGAKQKPLEKDAGSRTIE
WLEKIRNSNGLLPTSKIRLNMQRIMQNNAAVFRTQETLEEGVKLIDETWNSFHDVQVKDR
SLIWNSDLIETLELENLLINASITMHSAEARKESRGAHAREDFTKRDDEKWMKHSLGYWE
NEKVRLDYRPVHMNTLDDEIETFPPKARVY
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgagcggtgtctcgtggcttccgcattccggcgaagagatccggcgccggcgaa
gctttgaagcctcacagattattctccactgaagcgagggtgggaggctcatcgtatact
atagtggatcatacatatgatgcagtcgtggtaggtgctggtggtgctgggctcagagca
gctatagggttgtctgagcacggattcaacacagcatgcattactaagctcttcccgact
cgttcacacacagttgctgctcagggtggtataaatgctgcattaggtaatatgagtgag
gatgactggaggtggcacatgtatgacactgtcaagggaagtgattggctaggtgaccag
gatgccattcaatatatgtgtagagaagctccaaaggcagttattgagcttgagaactat
ggcctaccgttttccagaaccgaagaaggaaaaatttatcaacgtgcttttggtggtcaa
agtctagactttggcaaaggtggacaagcctaccggtgtgcatgtgctgctgatcgaact
gggcatgctttgttgcacacgttatatggtcaggccatgaagcataacacacaattcttt
gtggaatattttgctctggatctactcatggctagtgatggtagttgccagggtgtaatt
gcattaaatatggaagatggcactctgcatcgcttccagtcatcttcaacaattttggct
acaggaggatatggtagggcctacttttcggctacctcggctcatacttgcaccggggat
ggcaatgctatggttgctcgtgctgggcttccgcttgaggatcaggagtttgtgcagttc
catccaactggaatatatggtgctggctgcctcattactgaaggttctcgtggtgaagga
ggcattctcaggaacagtgaaggtgaaagatttatggaacgttatgcccctacggccaag
gaccttgcatcaagagatgttgtttcaaggtctatgacaatggaaattcgggaaggtcgt
ggtgtaggaccccagaaggatcacatatatctccacttgaatcacttaccaccagaggtc
ctgaaggagaggcttcctggtatctctgaaactgctgccatatttgctggtgttgatgtt
acaaaagaaccaattcctgttctacctaccgttcattataacatgggtggtattccaaca
aatcatcatggagaggtcgttacagttaaaggtaatgatcccgatgcaatagttcctgga
cttatggctgctggggaggcagcttgtgcatctgttcatggtgccaatcgccttggtgca
aactctctccttgacattgttgtgtttggtcgagcttgtgcaaatagggtagcagagatc
caaagaccaggagcaaagcaaaagccattagaaaaggatgctggttccaggaccattgag
tggttggaaaagataagaaattcaaatggcttacttccgacatcgaaaattcggttgaat
atgcaacgaataatgcaaaacaatgctgctgtattccgcacacaagagaccttagaggaa
ggggtaaaattgattgatgaaacttggaatagctttcatgatgttcaggtgaaggaccga
agtttgatatggaattctgacttgatagagacactagagttggaaaacctgttgatcaat
gcatctattaccatgcattctgctgaagcaagaaaagagagcagaggagcacacgcacgt
gaagattttacgaaaagagatgatgagaaatggatgaagcattcactgggatattgggag
aatgagaaggtacggcttgactataggcctgttcacatgaacacattagatgatgaaatt
gagactttcccacctaaagctcgtgtgtactga

DBGET integrated database retrieval system