KEGG   Dendrobium officinale: 110091884Help
Entry
110091884         CDS       T05027                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1-like
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
dct  Dendrobium officinale
Pathway
dct00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110091884
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dct03036]
    110091884
Enzymes [BR:dct01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110091884
Chromosome and associated proteins [BR:dct03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110091884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA SET Pre-SET
Motif
Other DBs
NCBI-GeneID: 110091884
NCBI-ProteinID: XP_020671829
LinkDB All DBs
Position
Unknown
AA seq 682 aa AA seqDB search
MEAQPVSSQEDVVLDAKPLRSLAPMFPAPYGFNTTFTSFGSAPAVCVSPFGGSSSSGGGF
PPFFFSPEPTNRQKGAASAGRASNRTPAANGSYHSDQINLEDDPDYTIHTTTSGRKIKRP
KTLKKYKIDDSDSESAEGSGKRKSQIRRKSKKAPELALIPSSLLDARNSAEEILMTFDAL
RRKILQLDEANDSSKRSYLRAGAIMMSNDLRANIVKRIGPVPGVEIGDIFYFRIEMCLVG
LHAQIMGGIDYMLPRLSDMDEPLAISIVSAGGYENDEGDTNILIYTGQGGGCSSKYDKNQ
VVDQKLERGNLALERSLHRGNLVRVIRSAKDMNLINGRIYIYDGLYKIQETWVEKAKAGN
NVFKYKLFRELEQPEGIAVWKNTEKWKANPSSRGGVILPDISSGIETFPVFLVNEVDNEK
GPSHFTYATKVKYLNPINSMRPLPGCRCISVCLPGDASCSCAQQNGGNLPYCANGFVVSR
KHVLYECNSLCSCSVNCRNRVTQKGVNLHFEVFRTRDRGWGLRSWDPIRAGTFICEYVGE
VVDKIKVNDFGEDDHYIFQGNYIDEKTLKWNHGPELLGEPSINESDVFKPLPIIISSRNV
GNVARFMNHSCSPNVFWQPVLHDHNEGDYPHIMFFAMKHIPPLMELTFDYGLNIENAVWN
VAGTRQPKKCLCGSPKCRGFFR
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggaagcccagcccgtttcgtcgcaagaagatgtagtattggatgccaaaccactgaga
tcattagcccctatgttccctgcaccttatggattcaacaccacatttacgtcctttggt
tccgcaccggctgtttgcgttagtccctttggtggttcatcgtcctctggcggtggtttc
cctccatttttcttcagtccagagccaaccaaccggcaaaaaggtgctgcatctgcaggg
cgtgctagtaatagaactccagctgcaaatggatcctaccattcggaccaaattaatctt
gaggatgatcctgattacactatccataccacgacttctggccggaaaatcaagcgtcct
aaaactttgaaaaagtacaagattgatgattctgacagcgagagcgctgagggcagtggc
aagaggaagtcccaaatacggagaaagtcaaaaaaagctccagagttagccttgattcct
tcctctcttcttgatgcacggaattcagctgaggagatactcatgaccttcgatgctctc
cgccggaaaatcttgcagttagacgaggcaaatgattccagcaaacgttcttacttgaga
gctggggctatcatgatgtccaatgatctccgggctaatattgtcaagagaatagggcct
gttcctggagtagaaataggagacatcttttactttagaatagagatgtgtttggttggt
ttgcatgctcaaatcatgggaggcattgattatatgttacctagactttctgatatggat
gaaccattagcaattagtattgtctctgctggaggttatgagaatgatgaaggtgataca
aatatattgatttacactggtcaggggggtggttgcagcagcaagtatgataaaaatcag
gtggtcgatcaaaaacttgagagaggtaatcttgcactcgagagaagtttgcatagaggc
aatcttgttcgggtgatacggagtgcgaaggatatgaacctcatcaatggaaggatctac
atctatgatggtctatataagattcaagaaacatgggtggagaaagcaaaggcaggtaac
aatgttttcaagtacaaattgttcagagagctagagcagccagaaggaattgcggtgtgg
aagaatactgagaaatggaaagctaatccttcttctagaggtggagttatactcccggac
atatcatccggtattgaaacttttcctgtttttcttgtaaatgaggttgataatgagaag
gggcctagccatttcacatatgccactaaagtaaagtatctaaatcccattaattccatg
agacctttacctggttgcaggtgcattagcgtatgccttcctggtgatgctagttgttct
tgtgcacaacaaaatggaggtaaccttccgtattgtgcaaatgggtttgttgtgagccgt
aaacatgttttgtatgagtgcaacagtttatgttcttgctctgttaattgccgtaataga
gttacacaaaaaggtgtcaatcttcattttgaagtttttaggacaagggatcggggttgg
ggccttcgatcatgggatcccatacgtgcaggtaccttcatatgtgaatacgttggagaa
gttgttgataagatcaaagtgaatgattttggtgaagatgatcattatatttttcaagga
aattatattgatgagaagacactcaaatggaatcatgggccggagttactgggtgaacct
agtatcaacgagagtgatgtttttaagccacttcctatcataattagttctagaaatgtg
ggaaatgttgctcgttttatgaaccacagttgttcccctaatgtcttttggcagccagtt
ctgcatgatcataatgagggagattatccacatatcatgttctttgcaatgaagcacatt
cctccattgatggagctgacatttgattatggtttgaacatcgaaaatgcagtttggaat
gttgctggcactaggcaaccaaagaaatgcttatgtgggtcgcccaaatgccgtggtttt
tttcggtaa

DBGET integrated database retrieval system