KEGG   Dendrobium catenatum: 110092220Help
Entry
110092220         CDS       T05027                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
dct  Dendrobium catenatum
Pathway
dct00620  Pyruvate metabolism
dct00710  Carbon fixation in photosynthetic organisms
dct01100  Metabolic pathways
dct01200  Carbon metabolism
Module
dct_M00168  CAM (Crassulacean acid metabolism), dark
dct_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
dct_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
dct_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    110092220
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110092220
Enzymes [BR:dct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     110092220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 MazG
Motif
Other DBs
NCBI-GeneID: 110092220
NCBI-ProteinID: XP_020672336
LinkDB All DBs
Position
Unknown
AA seq 965 aa AA seqDB search
MSRSTLERHASIDAQLRLLAPRKLSDDDKLVEYDALLLDRFLDILQELHGEDLRETVQEC
YELSAEYEGKHDSKKLEELGDVLTSLDPGDSIVVAKSFSHMLNLANLAEEVQIAFRRRIK
LKKGDFADENSATTESDIEETFKRLVYELKKSPEEVFDALKNQTIDLVFTAHPTQSVRRS
LLQKHGRVRNCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYFSQIEDLMFELSMWRCSDELRVRADELHRSSKKDAKHYIEFWKQVP
PNEPYRVILADVRDKLYNTRERSRHLLSSGHSDISDETTFTNVDQFLEPLELCYSSLCSC
GDRPIADGSLLDFMRQVSTFGLSLVRLDIRQESDRHTDVIDAITTHLGLGSYRDWSEEQR
QEWLLSELSGKRPLFGSDLPKTEEIADVLDTLHVISELPHDSFGAYIISMATAASDVLAV
ELLQRECHVKKPLRVVPLFEKLADLEAAPAALSRLFSINWYRNRIDGKQEVMIGYSDSGK
DAGRLSAAWQLYKAQEDLIKVAKEFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPISPKPEWRALLDEMAVVATE
EYRSIVFQEPRFVEYFRLATPEMEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGTAFKHAIEKDIKNLHMLQEMYNEWPFFRVTIDLVEMVFAKGNPGIAALYDK
LLVSDDLWSFGERLRANYEGTKNLLLKVAGHRDLLEGDPYLKQRLRLRDSYITTLNVCQA
CTLKRIRDPNFHVTVRPHISKDIIDSDKRAAELVKLNPTSEYAPGLEDTLILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atgtccaggagcacgctggagaggcatgcgtcaatagacgcgcagcttaggctgctggcg
ccgcgaaagttgtctgatgatgacaagcttgtggagtacgacgccttgttattggatcgc
ttcctcgacatccttcaggagttgcacggagaagatctcagagagacggttcaagagtgt
tatgagctttctgctgagtatgagggcaagcatgattccaagaagctggaggagcttggg
gatgtgctgacgagtttggatcctggggattcgatagttgtggccaagtccttttcacac
atgcttaatcttgccaacttggctgaggaagttcagattgcttttcgcaggagaattaag
ttgaaaaaaggagactttgctgatgaaaattctgcaactacagagtcagatattgaagag
acttttaagaggctcgtttatgagctgaaaaagtccccagaggaggtttttgatgctttg
aagaaccaaactattgatcttgtttttactgcacatccaactcagtccgtcagaagatcc
ttgcttcagaagcatggcagggtaaggaattgcttggctcaattatatgcaaaagacatc
actcctgatgacaagcaggaacttgatgaagctcttcagagggagatacaagctgccttt
aggactgatgaaatccgcagaactcctcccactcctcaagatgaaatgagggcaggaatg
agttactttcatgaaactatatggaagggtgtaccaaagtttcttcggcgtgttgataca
gctctgaaaaatattggaattaatgagcgtgttccttataatgctcctttaattcaattt
tcatcatggatgggtggtgatcgtgatgggaatcctagagttactcctgaagtcacaagg
gatgtgtgcttgttggcaagaatgatggctgcaaacttgtacttctcccagattgaagat
ttaatgtttgagttatctatgtggcgttgtagtgatgagcttcgagtccgagcagatgaa
ctacaccgttcgtcaaagaaagatgcaaaacactacatagagttctggaaacaagttcct
ccgaatgaaccatatcgtgtcatacttgctgatgttagggataagctttacaatacacgg
gaacgttctcggcatcttttgtccagtggacactccgacatttctgatgaaactactttc
accaatgttgatcagttcctggaaccccttgagctctgttacagttctctctgttcctgt
ggtgatagacctatcgccgatggaagccttcttgactttatgcgtcaagtatcaaccttt
gggctctccctagtgagactagatatcaggcaagaatctgatagacacactgatgttatt
gatgccattaccacacatcttgggttaggttcataccgtgactggtccgaggagcaacgt
caagagtggcttttatctgaattgagtggcaagcgccctttatttggttcagaccttccc
aaaactgaggaaattgctgatgttcttgacacacttcatgttatatcagagcttcctcat
gatagttttggagcttacataatttccatggcaactgctgcatctgatgtgctggcagtg
gagctcttgcagcgtgagtgccacgttaagaagccactgagagttgtgcctctttttgag
aaacttgctgatctcgaggcagcacctgctgctctatcccgtcttttctcaatcaactgg
tataggaacaggattgatggaaagcaggaggtcatgattggttattccgattctgggaag
gatgctggacgtctttctgcagcttggcagttgtataaagctcaagaagatctaataaag
gttgccaaagagtttggggtgaaactgacaatgttccatggacgagggggaactgttgga
agaggaggtggccctacccatctggctattttatctcagcctccagatacaattcatggt
tcacttcgagttactgttcaaggtgaagtaattgagcaatcttttggagaggaacatttg
tgtttcagaactcttcagcgctttactgctgccactcttgagcatggaatgcatccacca
atttcaccgaagccagaatggcgagcattgttggatgagatggctgttgttgccacggag
gaataccgctcaattgtcttccaagaaccacgttttgttgaatactttcgcctggccaca
cctgagatggaatatggtagaatgaacattggaagccgaccatctaaacgaaaacccagt
ggaggaatagaatctttacgagcaattccatggatttttgcatggactcaaacaaggttt
caccttcctgtgtggcttggttttgggaccgcattcaagcatgccattgagaaggacata
aaaaatcttcacatgctgcaagagatgtataatgaatggcctttctttagggtcacaatc
gacttggttgagatggtgtttgctaaaggaaaccctggcattgctgcattatatgacaaa
ctgttggtttcggatgatttgtggtcattcggggagaggctcagagctaattatgaagga
accaaaaatcttcttcttaaggttgctggccacagagatcttcttgaaggagacccctat
ttgaagcagagattgcgccttcgtgattcttacatcactactctaaatgtgtgccaagct
tgcaccctgaaaaggatcagagatccaaattttcatgtaactgtgaggcctcatatatca
aaggacataatcgattctgacaagcgagctgcagaactagtgaagctcaaccccacaagt
gagtatgctcctgggctggaagataccctcatcctcaccatgaaaggtattgctgctggg
atgcagaacactggttaa

DBGET integrated database retrieval system