KEGG   Dendrobium catenatum: 110093044Help
Entry
110093044         CDS       T05027                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
dct  Dendrobium catenatum
Pathway
dct00630  Glyoxylate and dicarboxylate metabolism
dct00710  Carbon fixation in photosynthetic organisms
dct01100  Metabolic pathways
dct01200  Carbon metabolism
Module
dct_M00165  Reductive pentose phosphate cycle (Calvin cycle)
dct_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
dct_M00532  Photorespiration
dct_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    110093044
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110093044
Enzymes [BR:dct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     110093044
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 110093044
NCBI-ProteinID: XP_020673453
LinkDB All DBs
Position
Unknown
AA seq 168 aa AA seqDB search
MSARFLIATQIPSYAGLRPEPSHKLSSAKASVQWQARRRVSNGSRVHCMKTWDPINNKRY
EVLSYLPPLSAESIAKEVDYMISKGWIPCLEFDEVGKIHRSNSNVPGYYDGRYWTLWKLP
MFGCTDSSQVLHEIDECRKAYPDAYIRLLSFDNVRQCQCMSFVIQKPT
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccagattccttattgcaacgcaaatcccaagctatgccgggctcaggcctgaa
ccatcccacaagctaagctctgcaaaagctagtgttcagtggcaagcaagaagaagagtc
tccaatggctcaagagttcattgcatgaagacatgggatcccataaacaacaaaaggtat
gaggtattatcctatttacctcccctctcagctgaatcaattgcaaaggaagttgattat
atgatctcaaagggatggattccttgcttggaattcgatgaggttgggaaaatacataga
agcaactctaacgtcccaggctactatgacggcaggtattggacactgtggaagttgcct
atgtttgggtgcactgattcctctcaagtgctacatgagattgatgagtgtagaaaggca
tatcctgatgcatacatacgtcttctttcctttgacaatgtgcggcagtgtcagtgcatg
tcctttgttatccagaagcctacctaa

DBGET integrated database retrieval system