KEGG   Dendrobium catenatum: 110093394
Entry
110093394         CDS       T05027                                 

Definition
(RefSeq) putrescine hydroxycinnamoyltransferase 1-like
  KO
K13065  shikimate O-hydroxycinnamoyltransferase [EC:2.3.1.133]
Organism
dct  Dendrobium catenatum
Pathway
dct00940  Phenylpropanoid biosynthesis
dct00941  Flavonoid biosynthesis
dct00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
dct01100  Metabolic pathways
dct01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    110093394
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    110093394
   00941 Flavonoid biosynthesis
    110093394
Enzymes [BR:dct01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.133  shikimate O-hydroxycinnamoyltransferase
     110093394
SSDB
Motif
Pfam: Transferase WES_acyltransf
Other DBs
NCBI-GeneID: 110093394
NCBI-ProteinID: XP_020673926
LinkDB
Position
Unknown
AA seq 447 aa
MGVYPTIEILEKGLVVPSEETPAKEIWLSNLDLLATRHHTPTVYFYRRPFNDDGFFLPET
LKASLARALVPFYPLAGRLVSGADGRPWIRCTAEGALFVVAKSESAVEDFGDFAPSDEFR
RLLVPCVDGADEADMPLVLLQLTFFRCGGVCLGTAIHHTAADGLGSLHFINSWARITHTD
TQIPILPSVNRTILRARSPPSITSTTQIDCYTTQSTQSAPSSTNPPFTSAILKLSNHHLS
LLKTTPNKNNPKPPLSTFKAVVSHIWRSACKARGLDPSCSTRIYIAADTRTRLRPPLPDG
YLGNAVFRTSAKATAGEVLSELGAAAKIDDAVKALDDEFIRSLVDYLEEKVNDVGLRKDG
WVMPQTDLWVVSWMGMPVYDADFGWGKPVYMGRACMQFGGLAYLMPSSPEEEEEGGVSVV
MTMEEGKMGRFKEIFYEDIGSAGSAHN
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgggggtgtatccgacgatcgaaatcctggaaaagggacttgtagtccccagcgaggaa
accccggcgaaggaaatctggctctccaacctcgacctcctcgccacacgccaccacacc
ccgacggtctacttctaccgccgccccttcaatgacgacggattcttcttgccagaaaca
ctcaaggccagcctagctcgcgcgctcgttccattctaccctctcgccggccgcctcgtt
tccggagccgacggtcgtccttggatccgatgcacggccgagggtgccctctttgtcgtc
gcaaaatcagaatcggccgttgaagatttcggggattttgcaccttccgatgagttccgg
cggcttcttgttccttgtgttgatggcgccgacgaggctgatatgccgcttgtgctgtta
cagctaaccttcttccggtgcggcggcgtctgccttggcacggctattcaccacaccgcc
gccgacggtctcggatccctccactttataaattcgtgggccagaatcacccacaccgac
actcaaattcccatcctcccgtccgtcaaccgcaccatcctccgagcccgctcccctcca
tccataacctccaccacccaaatcgactgctacaccacccaatccacacagtctgctcct
tcctccactaaccctcccttcacctccgccatcctcaaactctccaaccaccatctctcc
cttctcaaaaccacccccaacaaaaacaatcctaaaccccctctttccaccttcaaagcc
gtcgtctcccacatctggcgctccgcctgcaaagcccgtgggctcgacccatcctgctcg
actcgaatctacattgccgccgacacccgtacccgcctgcgaccgcctctccccgacggc
tacctgggcaatgccgtcttccgcacgtcggcgaaggccacggcaggggaggtactgtcg
gagcttggagcggccgcgaagattgacgatgcggtgaaggcacttgatgatgagtttata
aggtcgttggtggattacttggaggagaaagtgaatgatgttgggctgaggaaagatggg
tgggttatgccgcagacggatttgtgggtggttagttggatgggaatgccggtttatgat
gcggatttcgggtgggggaagccggtttatatgggaagagcgtgtatgcagttcggtggc
ttggcttatcttatgccgagctcgccggaggaggaggaagaaggaggcgtttcggttgtg
atgacaatggaggagggtaaaatgggaaggttcaaggagatattttatgaagacattggg
agtgctggttcggctcataactga

DBGET integrated database retrieval system