KEGG   Dendrobium catenatum: 110094824Help
Entry
110094824         CDS       T05027                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
dct  Dendrobium catenatum
Pathway
dct00564  Glycerophospholipid metabolism
dct01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110094824
Enzymes [BR:dct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     110094824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 Pyr_redox GIDA FAD_binding_3 Pyr_redox_3 HI0933_like Lycopene_cycl NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 110094824
NCBI-ProteinID: XP_020675812
LinkDB All DBs
Position
Unknown
AA seq 631 aa AA seqDB search
MAASKLRALGAVMAATGMSYTAVTLLSSPVSASDRGATAALESARRRTTDPAAIVPSREV
QAAALMGASAASPLDVLVIGGGATGCGVALDAVSRGLRVGLVEREDFSSGTSSRSTKLIH
GGVRYLEKAVFNLDYGQLKLVFHALKERKQVIENAPHLCHALPCMTPCFDWFETLYYWVG
LKMYDLVAGRRMLHLSRYYSADESIELFPTLARKGHNRSLKGTVVYYDGQMNDSRLNVGL
ACTAALLGASVFNHAEVISLIKDENNERIIGAHIRDNLSRKEFDTYAKVVVNAAGPFCDS
IRRMANKEAPNMISPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTD
SSTVITMYPEPHEDEIRFILDAISDYLNVQVRRTDVLSAWSGIRPLAMDPSAKNTESLSR
DHVVHEDHPGLITITGGKWTTYRSMAEDAVNAAVRSGKLSPSNGCVTENLCIVGGDGWEP
ASFTTLAQYYTRMKKTHGGKVIPGIMDSAISKHLSHAYGTSAERVALIAQNENLGKRLAH
GYPFLEAEVAYCARHEYCESAVDFIARRSRLAFLDTAAARRAIPRVIEILASEHKWDKAR
KKHELQMAKDFLETFKSSKNAQFHDGKHTSK
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcgaaattgagggctcttggagcggtcatggcggcgacgggaatgtcttac
acggcggtgaccctcctgtcttcgccggtttccgcaagtgaccgcggggcgaccgctgcg
ttggaaagcgcgcggcggcggacaaccgatccggcagccatcgtaccttccagggaggtc
caagcggctgcgttgatgggtgcttccgcggctagccctctcgacgtccttgtgatcggt
ggcggcgccaccggctgcggcgtggctctcgatgccgtatcacgcggcctgcgagtaggc
ctcgtcgagagggaggatttctcgtcgggaacctcatcgcgctccaccaagcttattcat
ggaggggtaagatacttagaaaaagctgtctttaatcttgattatggacagcttaagctt
gttttccatgcattgaaggagagaaaacaagttattgagaacgctcctcacttatgccat
gctttgccatgcatgacaccttgttttgattggtttgagactctgtattattgggttgga
ttaaaaatgtatgatcttgttgctggtagaagaatgttgcatttgtccagatactattct
gccgatgagtcaattgagcttttccctacactggccagaaaaggccataatagaagtctc
aaagggacagtagtttattacgatggacaaatgaatgattctcgcctgaatgttggacta
gcttgcactgctgctttattgggtgcttcggtattcaaccatgcagaagttatatcatta
attaaggatgagaacaacgagcggattattggtgcccacatccgagataatctgtcaaga
aaagagtttgacacttatgcaaaagtagttgtaaatgctgctggaccattttgtgactca
ataaggcgcatggctaacaaagaggcaccaaacatgatttctccaagtagcggtgtgcac
atcgttcttcctgactattattctcctgaagggatgggtctaattgttcccaagacaaaa
gatggtcgtgttgtattcatgcttccttggttgggaagaacagttgcaggaaccacagat
tccagcactgtcattaccatgtaccctgaacctcatgaagatgaaatacgatttattctg
gatgccatcagtgattacctgaatgttcaggttaggcgtactgatgtcctttcagcttgg
agtggtatccgacccttagccatggacccatcagcaaagaacactgagagtttatctaga
gatcatgtcgtccatgaggatcatcctggtttaattactatcacaggaggaaaatggaca
acttatagaagcatggctgaagatgcagttaatgcagcagttagatctggcaagctgagt
cccagcaatggctgtgtgactgaaaatctctgtattgttggaggagatggatgggagcca
gcatcgttcaccacacttgctcaatactatacacgcatgaaaaaaacacatggcggtaaa
gttattcctggcattatggacagtgcaatctctaaacatttgtcacatgcatacggcact
tcagcggaaagagtggctctgattgctcagaatgaaaatctaggcaagaggcttgcccat
gggtacccattcctggaggctgaggtagcatactgtgctcggcatgagtactgcgaatct
gctgtcgatttcatcgccaggcgatctcggcttgcttttctcgatactgctgctgcaagg
agagcaataccccgtgtgattgagattttagcttctgagcacaagtgggacaaggctagg
aagaagcatgagctccaaatggccaaagactttctggaaaccttcaagtcatccaaaaat
gcccaatttcatgatggaaaacatacaagtaaataa

DBGET integrated database retrieval system