KEGG   Dendrobium catenatum: 110095694Help
Entry
110095694         CDS       T05027                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
dct  Dendrobium catenatum
Pathway
dct00562  Inositol phosphate metabolism
dct01100  Metabolic pathways
dct04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110095694
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    110095694
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dct01009]
    110095694
Enzymes [BR:dct01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     110095694
    3.1.3.48  protein-tyrosine-phosphatase
     110095694
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     110095694
Protein phosphatases and associated proteins [BR:dct01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    110095694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase3 Y_phosphatase CDKN3
Motif
Other DBs
NCBI-GeneID: 110095694
NCBI-ProteinID: XP_028548078
LinkDB All DBs
Position
Unknown
AA seq 601 aa AA seqDB search
MASSQSNSSPSRPVSNDSQHSDRRESPSLLSSSGITSWAKNLKIPQAAVQEDPQTGNAGK
STFARFTSGLGLRLSPKSTQKDDNAEGSPTPTQQGVFGSLTKGFVDSSKNAVKAVQVKAR
HIVSQNKRRYQEGGFDLDLTYITENIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIRFFE
THHKGKYKVYNLCSERLYDASLLEGKVACFPFDDHNCPPIELVTLFCQSAYNWLKEDIEN
VVVVHCKAGMARTGLMISSLLLYLKFFPTAEESIEYYNQKRCIDGKGLVLPSQIRYVKYF
ERTLTYFNGENQPGRRCMLRGFRLHRCPYWIRPSITISNHNGILFSTKKHPRTKDLLPED
FWFSAPKKGIMVFALPGESGLTEVAGDFKINFHDRQGDFYCWLNTTMTENRKVLNTSDLD
GFDKRKLPSPGFQVEIVLADYNGSVSPRPSQPAPNNETDGASTTINTHAEESNTSLPPNT
NMETRNKDDVFSDSEAEEGGSTKSKRSPATNVSAAAHVIATKGSATEPSSKSELYNITHG
IEQVSLKAKEASMPAPEARTEENKNSPFRAPELESTSTSEFKAIAADASVFSFGDEDYES
E
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcatcacaatccaattcatctccttcacgtccagtttcaaatgacagtcagcat
tctgacagacgagaatcaccgtcgcttttgtcctcctctggaatcacctcctgggccaaa
aacttgaagataccacaggctgcggtccaagaagaccctcaaacaggaaatgcaggaaag
tcaacatttgctcgttttacgagtggattgggactacgtttatctcccaaatcaactcag
aaagatgataatgctgagggttccccaacgcctactcaacaaggtgtttttggctctttg
actaaaggatttgttgactcgtcaaaaaatgcggtcaaggctgtacaagtgaaggctcgt
cacattgtctctcaaaacaaaaggagatatcaggaaggtggatttgatttggatttgact
tatatcacagaaaatataattgctatgggtttccctgcgggtgatatgagttcagggttt
tttggctatgttgagggattttatcgtaaccatatggaggaagtgatacgattttttgaa
actcaccacaagggaaagtacaaggtatacaatctttgttcagagaggctctatgatgca
tcactacttgagggcaaggttgcttgtttcccatttgatgatcataattgcccgccaatt
gagcttgtgacattgttttgtcaaagtgcctataattggttgaaggaagacattgaaaat
gttgttgttgtacactgcaaagctggtatggcaagaacgggtttgatgatatctagcctt
cttttatatctaaagttctttccaactgctgaggaatcaatcgagtattacaaccagaaa
agatgcatagatgggaagggtcttgttctcccaagtcagattagatatgtcaagtatttt
gagcgcacattaacatattttaatggagaaaatcaaccaggccgcaggtgcatgctaagg
ggttttcggttacatagatgcccttattggataagaccttcaattactatctctaatcat
aatggtattctcttttctaccaaaaagcatcccaggactaaagacttgctgcctgaggat
ttctggtttagtgcaccaaagaaaggaattatggtatttgctttacctggtgaatctggt
cttacggaagtggctggggatttcaaaatcaatttccatgatcgacaaggagatttctat
tgttggttgaacactacaatgacagaaaacaggaaggtcctgaatacctctgatcttgat
ggctttgataagagaaaactaccatctccaggattccaagttgagattgttcttgcagac
tataatggttctgtatcccctagaccttctcaaccagctcccaacaatgaaactgatggg
gcctcgacgaccataaacacccacgccgaagaaagcaacacgtcacttcctcctaacaca
aacatggaaactcgaaacaaggacgatgtattttccgatagtgaggctgaagagggaggt
tctacgaagagcaaacggtctccggccaccaatgtatctgcagcagcccatgttatcgcc
actaaaggatctgcaacagaaccatcttcgaaaagtgaattatacaatataacccatgga
atcgaacaagtctccctcaaagctaaggaagcttcaatgccagctccagaggcaagaaca
gaggagaataagaactcgccatttcgagcccccgagttggaatctactagcacaagcgag
ttcaaggccatcgccgcagatgcctccgtcttctcttttggtgatgaggactatgaaagc
gagtag

DBGET integrated database retrieval system