KEGG   Dendrobium officinale: 110097541Help
Entry
110097541         CDS       T05027                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH2
Organism
dct  Dendrobium officinale
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-CW
Motif
Other DBs
NCBI-GeneID: 110097541
NCBI-ProteinID: XP_020679633
LinkDB All DBs
Position
Unknown
AA seq 1992 aa AA seqDB search
MDIGDSKDSIALPSSDNDCYLMGYENYFSDSQTESAVNLGMPSSHHSDNHVNVVSDLEES
RINALELAKVVEAEELFAKEEYKNVEEEAPGIAVEEEQDVFPGLSPLRGDCVMSSSNIGT
GVEVEYISRMFEDGRGCIGCENCLFSSRTVVDGPLVDVNVDLAKQRNGFCCLSPSSECAV
ASEISHGSSMEGNNGSSSNVESYKTNIDSSSGNVVFLVDRTKDDKQSCSLQNGRGLRLQY
ARKLKETHQFNNFACSHEEKFAEEEILGVPRADHEASCSAQGSTSEPTYYSAVERSIYEK
LSHTSSSFACGSIGTTEPDFKRSSFGSVKMTSTFCTNDKEFCTDAEKLTGAILSSSSITF
VRRTNPKRAVSFRSNLADGKSNQLITFQSDRRKCRRKFSASTSRAPVTLNMFGEVKRKLR
NSRRQARLSVWGTVENFTPIISQRDELIKLDSEPNAVRKRRSKNAVSAANRRKRTAALKN
KLSRSASNKISSASCQSIPLVKRDRQTSFKNGIDHFIGTCDGHSTSETSSTKVELEQNYL
EKWYSVVSSNTRVGQLGEKDLESTLTQETSADNLPSEGHGVLSPVDFEFVAETVDDKQTS
KPGDSPDSDVYNPVGDVEILAGAGSAIIKLESVSNQNSEIQEPKEENGLPSTELNFIEPF
VPHLPLLAKQVQAGENPRSNPRKSQGGKKKLKEKKGKSVKKGNKDNQEKTGQVSECPFLL
SDTACVEERLGCLEKSNAVKKASLSSNCCPKSKGARDKGGKCSKSIRKHCKRGSKSGSLL
LNSSVSGLADLANFNHHLEIQNRTETTDNPLQHDYNGLFEALVPSDYVECQVRKRTKKRL
CKKKSSRTCSIRQRRKFIYGEPKGNKGKSDQVRMDNLFPKEIDSLGFSPGTDNKLSLVGG
QMHGEAAAIDTSLKDASNDVASPAFDEQSARELYNIFLGQSSLSGKKAWALCDDCQKWRC
VPDELVHVIEKNKWTCKDNVDEAFADCTIPQEKTDDEINNDLGISVGGFCSTELHGCGEL
VPLRLSDTARPTWTRIKSNLFLHRNRRSLTIDEIMVCHCKPPPDGSLGCGEECLNRILNI
ECVKGTCPCGNLCSNQQFQKRKYSKFKWIKCGKKGYGLQLEEVASRGQFLIEYVGEVLDL
AAYEERLRYYACRGHKHFYFMTLNGGEVIDACSKGNLGRYVNHSCDPNCRTEKWMVNGEV
CIGLFAIRDIKKGEEITFDYNYVRVFGAAAKKCVCGSVECRGYIGGDPSSSEVIVQDDSD
ADDPEPVMIDEYGDNELGVTRIDSDTTDAKEANHENFSVERKDTNGNMTMSEQRAFVENQ
SFDNQDVIHPTSSEHDLTDGLMQSSNSVESKNSLSTLSDGQPFQDQQLVLSNIEPDQNFC
DVVNESLPLSAAFGSLPSGQLSERSTHCLNTFLQSDHAAQKPVTDDATKISSQNSDSFMR
RSSATCPIEEILMVPKPNNVVKALQPVKIKRSRVSIRSVSSGKTKKVSAAISSRHISRHI
EVEEKLNELLDEDGGIRRQKDAAKGYLKLLVVTAAAGDETSGSMSQSARDLSLILDAILK
TKSRMVLVDIINKNGLRMLHNMMKQNRDNFNRIPILRKLLKVLEFLAEKEILTRDHIYAA
PPCSKMESFKESMLKLMKHRDSQVLHIARNFADQWIPRNFSRVEPSEKDGKHICTKYPRH
NWCPTSKIHSWHEHGKQESSSIVSGSAANCLPSSEVDMQREAFPLPTQQASSSASFTDNS
PIERTRSRKRKSRWDQPADATIPVGQAYECLTDQPMLSIMKHMRPSQLEPLPDIDVSKQK
SEAQTKGNNSSDVIAVQESLQQNSDDDDEMPPGFESPCIDECPQLASSATNMTGDVVIGH
PLERYLPYLTVSYGMPIDLMHQLGIPETEVSTQFDPSWKIAPAIPFKPFPPLPSYPRQEP
CTSNTWNTSFNENINTPTKAKGLQEKIFQSRNERARFPKYGNGRRFFKPQQWNNQRSQRC
GSRWSQRGNAFS
NT seq 5979 nt NT seq  +upstreamnt  +downstreamnt
atggacattggagatagcaaggatagcatcgccttgccatcttcagacaatgactgctat
ttgatgggttatgagaactatttcagtgattctcaaacagagtctgctgtaaatttgggg
atgccatcctctcatcacagtgataaccatgtaaatgtggtatcggatttggaggagagc
agaattaatgctttagagcttgcaaaggttgttgaggcagaagagttatttgccaaggaa
gagtacaagaacgtggaagaagaagcaccgggtatagctgtggaggaagagcaggatgtc
ttccctgggctgtctcccttgagaggagattgtgtgatgagttcttccaatattggcact
ggagttgaagttgagtacatatccaggatgtttgaggatggtagaggctgcattggttgt
gaaaactgtctcttttcttcaagaacggttgttgatggccctttggtggatgttaatgta
gatctggctaaacaaagaaatggattttgctgtctgtctccttctagcgagtgtgcagta
gcttcagaaatctcacatggtagttcaatggaagggaataatggaagctcgtctaatgta
gagtcttataagacgaacattgatagtagcagtggcaatgtagttttcttggttgacagg
accaaagatgacaagcaatcttgcagcttacagaatggtcggggtttgcgtctacagtat
gctagaaagctgaaagagacccatcaatttaataactttgcctgttcacatgaagaaaaa
tttgctgaggaagagatattaggtgttccacgggctgatcatgaagctagctgttcagca
caagggtcaaccagtgaaccaacatattattctgcagtagaaagatctatttatgagaag
ctatctcatacctcctcttcttttgcttgtggttcaataggcaccaccgagcctgatttc
aagagaagttcttttggttctgtcaaaatgacgtcaactttctgtaccaatgataaggag
ttttgcacggacgcagagaaactaactggtgctattctatcttctagttccatcactttt
gttagacgcaccaatcccaaacgtgctgtttcatttaggagcaatttggctgatggaaaa
tctaatcagctaatcacgttccaaagtgataggagaaaatgcaggagaaagttcagtgca
agcacttctcgggcaccagttacgcttaacatgtttggagaagtaaaaaggaagttaaga
aattctcgtaggcaggcacgtctttctgtttggggaacagttgaaaatttcacccccatt
atcagtcaaagagatgagcttataaagcttgactcggagccaaatgctgttaggaaaaga
agatcaaagaatgcagtatctgctgccaatagaagaaaaagaacagctgccctaaaaaat
aaactgtcccgatcggcctcaaataaaatatcttctgcatcttgtcaatctattccacta
gttaagcgtgatagacaaacatccttcaaaaatggtatagatcatttcataggaacttgt
gatggccatagtacttctgaaacttctagcacgaaggttgaattagagcaaaactactta
gaaaaatggtattctgtagtcagctctaacacaagagtgggacaactgggagaaaaggac
ttggagagcactttgacacaagaaacatctgctgacaacttgccatcagaaggccatgga
gttttatctccagtagattttgagtttgttgcagaaactgttgatgataagcaaacatca
aaacccggtgattctcctgattctgatgtttataatcctgtcggagatgttgaaatattg
gcaggtgcgggttctgctattattaagctagagtctgtttcaaatcagaacagtgaaatt
caagaaccaaaggaagaaaatggcttgccgtctaccgagctaaattttattgaaccgttt
gtacctcatttacctttactggcaaaacaagtgcaagcaggtgagaatccgagaagtaat
cccaggaaaagtcaggggggaaagaaaaaactgaaagaaaagaaaggaaagagtgtaaag
aaagggaataaagataatcaagagaagacaggtcaggtcagtgagtgtccatttttatta
tctgatactgcttgcgttgaggagaggttgggttgtctggaaaagtcaaatgcggttaag
aaggcctcactaagcagtaactgctgtcccaagagcaagggggcacgtgataaaggtggc
aaatgttcaaaatctattagaaagcactgtaaaagaggatcaaaatcagggagtttactt
ttaaattcttcagtttctggtttggctgacttggctaacttcaatcatcatctggaaata
caaaacagaacagaaaccactgacaaccctttgcagcacgattataatggactttttgag
gcattagtgccttctgattatgttgagtgccaagttaggaaaagaaccaaaaaaaggttg
tgtaaaaagaaatcaagccgcacatgttcaataaggcaaagaagaaaatttatttatggt
gaaccgaagggaaataaggggaaatctgaccaagttaggatggataatctttttccaaaa
gaaattgatagcttgggattttctccgggaacagacaacaagttgtcactggttgggggt
caaatgcacggtgaagcagctgcaattgatacttcgctaaaggatgcgtcaaacgatgtt
gcatcaccagcatttgatgagcaatcagcgagagagctatataatatttttttgggccag
tcttcactctcaggtaaaaaagcatgggctctttgcgatgactgccagaaatggcgttgc
gtgccagatgagcttgtgcatgttattgagaaaaacaaatggacttgtaaagacaatgtt
gatgaagcatttgctgactgtacaataccacaagagaaaacggatgatgaaattaataat
gatcttgggatctcagttgggggcttctgctctacagaactgcatggttgcggggagctt
gtaccactgagactatctgatacggctcgacctacatggactcgtattaaatccaatttg
tttcttcatcgtaatcgtagatctttgactattgatgagatcatggtctgccattgtaaa
ccgcctccagatggcagtttgggctgtggagaggaatgtttgaaccgtattcttaatatt
gagtgtgtcaagggaacctgcccatgtgggaatctatgttcaaatcaacagttccaaaag
cgcaaatattccaaattcaagtggatcaaatgtggaaagaaaggctatgggctgcagttg
gaagaggttgcttcgagaggacagtttctcattgaatatgttggggaggtgcttgattta
gctgcttatgaagaacggctaagatattatgcttgcagaggtcataagcatttctacttt
atgacgttgaatggtggtgaggtgatagatgcatgttctaagggaaacttggggcgttat
gttaatcacagctgcgatcctaattgtcgcactgaaaagtggatggttaatggagaggtg
tgtattggcctgtttgctattcgggatatcaagaagggtgaagaaatcacgtttgattac
aactatgtaagggtgtttggtgccgctgctaagaaatgtgtgtgtggttctgttgagtgc
cgtggttacataggtggtgatccatcaagctctgaggttattgtacaagatgattcagat
gcagacgatcctgagccagtaatgattgatgaatatggtgataatgagctaggcgttaca
aggattgattctgatacaactgatgctaaggaagctaaccatgaaaatttttctgttgag
agaaaggacacaaacggtaatatgaccatgtcagagcaacgggcttttgtagaaaatcaa
agttttgataatcaagatgtgattcatccgacatcatctgaacatgatctgactgatggt
ttgatgcagtcttcaaattctgtagaatctaaaaatagcctgtctacattatctgacggt
caaccgttccaggatcagcagctagttttgagcaacattgaacctgatcaaaacttttgt
gatgttgtaaatgagagtctgccattgagtgctgccttcggatctttaccttctgggcag
ctatcagaaagatctacgcactgtctgaatacttttctccaaagtgatcatgcagcgcaa
aaacctgtcacagatgatgctacaaagatttcttcccaaaattcagattctttcatgcgt
agaagtagtgcaacttgcccaattgaagaaattctaatggtaccaaaacctaataatgtt
gtgaaagccttgcaacctgtaaaaattaaacggagcagggtaagtattagaagcgtgtct
tccggaaaaacaaagaaagtgtctgctgctattagcagtcggcatattagcaggcatatc
gaagttgaagaaaaacttaatgagctgctagatgaggatgggggcatacgcaggcagaaa
gatgctgctaaaggatacttgaagcttttagttgtaacagcagcagcaggggatgaaacc
agtggcagcatgtcccagagtgctcgagatctttcgttgattcttgatgcaattttgaaa
acaaagtctcggatggttttggttgatataataaacaaaaatggattgcgaatgctgcac
aatatgatgaagcagaaccgtgataacttcaacagaattcccattcttcggaaacttctt
aaggtcttagaatttcttgcagagaaagaaattcttactagggatcatatatatgccgct
cctccttgcagtaaaatggaaagcttcaaggaatcaatgttaaagctgatgaagcatagg
gactctcaggttcttcacattgcacgaaactttgcagaccaatggatacctcgtaatttt
agtagggtggagccttctgagaaagatggtaagcatatatgtactaagtatccccgccat
aattggtgtccgacatcaaaaatccattcgtggcatgagcatggaaagcaagaatctagt
tcgatagttagtggtagtgcagcaaattgcctgccttcatctgaagtagatatgcaaaga
gaagcttttcctcttcctactcaacaggcgtccagctctgcatccttcactgacaatagt
ccaatagaaaggacaagatctcgaaaacgtaaaagcagatgggaccagccagcagatgcc
actattcctgttggacaggcttatgaatgcttaactgatcagcctatgcttagtattatg
aagcacatgaggccttcacaacttgagcctcttcctgatattgatgtttcaaagcaaaaa
tcagaggcacagactaaaggaaacaactcttctgatgttatcgctgttcaggagtcctta
cagcaaaatagtgatgatgatgatgaaatgccgcctgggtttgagtctccctgcatagat
gaatgccctcagctagctagctcagctactaacatgacaggagatgtggtgattgggcat
ccgctggagagatatcttccatacttaactgtttcttatggcatgccaattgacctgatg
catcagctgggaatccctgaaactgaagtcagcactcagttcgatccatcttggaaaatt
gcacctgctattcctttcaaacctttccctcccctgccttcatatcctcgacaagagccc
tgtacatcaaacacatggaacacatcttttaatgaaaatattaatactccgaccaaggca
aaaggcctacaagaaaaaatttttcaatctagaaatgaaagagcaaggtttcctaaatat
ggtaatgggagaaggttcttcaaacctcagcagtggaataaccaaaggtctcaaagatgc
gggtcccgttggtcccagagagggaatgctttcagttga

DBGET integrated database retrieval system