KEGG   Dendrobium catenatum: 110097926Help
Entry
110097926         CDS       T05027                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dct  Dendrobium catenatum
Pathway
dct04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dct00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110097926
Enzymes [BR:dct01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     110097926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 110097926
NCBI-ProteinID: XP_020680246
LinkDB All DBs
Position
Unknown
AA seq 215 aa AA seqDB search
MASVPAAANAIIAAKPSCSPLLPLSPSSCPFSSALSGQPLRLQSRRFAAAVMPRRMTVVF
AKKKAVAVLKGSSKVEGVVTLVQEDDGPTTVNVRVTGLTPGSHGFHLHEFGDTTNGCIST
GAHFNPNSLTHGAPEDEVRHAGDLGNIVANDEGIAEATIVDNQIPLEGPNSVVGRAFVVH
ELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPLQ
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgttcccgccgctgctaacgccatcatcgccgccaagccgtcgtgctctcct
ctgctgcctctttcacccagtagctgccccttttcctctgctctctccggccagcccctt
cgactacaatctcgaagattcgccgcagccgtaatgcctcgccgtatgaccgtcgtgttc
gctaagaagaaggccgttgctgtccttaagggcagctccaaggttgagggcgttgtcacc
ctcgtccaagaagatgacgggcccacaactgttaatgttcgtgtcacgggacttactcca
ggatctcatggtttccatcttcatgaatttggggatactaccaatggatgcatttcaaca
ggtgcccatttcaaccctaacagcctgacacatggtgctcctgaagatgaagtccgtcat
gcgggtgatttgggaaatatagttgctaatgatgaaggtatagctgaggcgacaattgta
gataatcagataccactcgagggacctaattctgttgttggaagagcatttgtggttcat
gagcttgaggatgatcttggaaagggaggacatgaacttagccttacaactggaaatgca
ggtggcagattggcttgtggtgtggttggtctgacgccccttcagtaa

DBGET integrated database retrieval system