KEGG   Dendrobium catenatum: 110098030Help
Entry
110098030         CDS       T05027                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dct  Dendrobium catenatum
Pathway
dct00020  Citrate cycle (TCA cycle)
dct00190  Oxidative phosphorylation
dct01100  Metabolic pathways
dct01110  Biosynthesis of secondary metabolites
dct01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110098030
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110098030
Enzymes [BR:dct01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     110098030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 110098030
NCBI-ProteinID: XP_020680388
LinkDB All DBs
Position
Unknown
AA seq 630 aa AA seqDB search
MWRAALSQAIRLSSSKKASITSDLVSRPSRFFSTSSSSYTIVDHTYDAVVVGAGGAGLRA
AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQ
DAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLNFGKGGQAYRCACAADRT
GHALLHTLYGQAMKHNTQFFVEYFALDLLMDSSGSCQGVIALNMEDGTLHRFSAKSTILA
TGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEGSRGEG
GILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEV
LKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVHIKGSDPDTVVPG
LLAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQKPGEKQSPLERDAGERTIA
WLDKLRNSNGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCKLIDKAWESFHDVKISDR
TLIWNSDLIETLELENLLINACITMHSAEARKESRGAHAREDFSKRDDANWMKHSLGYWE
NEKVRLAYRPVHMNTLDDEIEPFPPKARVY
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgtgcagcgctctcccaagccattcgcctatcctcatcgaagaaagcctcaatc
acgagcgatctcgtctccagaccttcgaggtttttttcaaccagctcgtcctcatacacc
attgttgatcacacatatgatgctgtggtggttggagctggtggagctgggcttagagca
gctattggactctcagaacatggtttcaatacggcttgcatcacgaagctcttccccact
agatctcatactgttgctgcgcagggtgggattaatgcagcattgggaaatatgagtgag
gatgactggagatggcacatgtatgatacagtcaaaggaagcgattggttaggtgatcag
gacgctattcaatatatgtgtagagaggcaccaaaggcagtcattgaacttgaaaattat
ggtcttccattttctagaacagaagatgggaaaatatatcagcgtgcttttggagggcaa
agcttgaattttggaaaaggtggccaagcctatcgctgcgcctgtgctgctgatcgcact
ggccatgcattattacacactctttatggccaggcaatgaagcataacactcagttcttc
gttgaatattttgcactagatcttcttatggatagcagcgggtcctgtcaaggcgtgatt
gcactgaacatggaggatggaacacttcatcgatttagtgccaaatccacaattttagcc
actgggggctatggaagagcttacttttctgcaacctctgctcatacatgcaccggagat
ggtaatgctatggtagctcgtgctggtttacctcttgaggatcttgaatttgtacagttc
catcctactggcatttatggtgctggctgtctcattactgaaggatctcggggtgaaggt
ggcattcttaggaacagtgaaggtgaacgtttcatggaacgttatgctcctactgcaaag
gatcttgcttcaagggatgttgtttcaagatctatgacaatggaaattcgagaaggacgt
ggtgttggaccactaaaggatcatatttatctacacctgaatcacctacctccagaggta
cttaaggaaaggcttcctggtatatcagaaactgctgcaatttttgctggggttgacgtc
accaaggagcctattccggtgctacccacagtacactataatatgggtggaatccccact
aactaccatggggaggtagttcacattaaaggcagtgatccagatacagtagttcctggt
ctattggctgcgggtgaggctgcctgtgcatcagttcatggagcaaatcgacttggtgct
aattcacttcttgacatagttgtatttggcagagcttgtgcaaacagagttgcagagatt
cagaagccaggcgagaaacagagccctcttgaaagggacgctggggagaggacaattgcc
tggcttgataaactgagaaattccaatggctccttgccaacttcaaaaattcgtctcaat
atgcaaagagtgatgcaaaataatgctgctgtatttagaactcaggagacattggaagaa
ggttgcaaattgattgacaaagcgtgggagagttttcatgatgttaaaattagtgatcga
accctaatatggaattctgatctgatagaaactctagagctagaaaatcttttgataaat
gcctgtataaccatgcattctgctgaagcaaggaaagaaagtagaggagctcatgctcgt
gaagattttagtaaaagagatgatgctaattggatgaaacactcacttggatattgggag
aatgaaaaggttcggctggcgtatagacctgttcatatgaatacactggatgatgaaatt
gaaccatttccaccaaaagctcgtgtttactga

DBGET integrated database retrieval system