KEGG   Dendrobium catenatum: 110101547Help
Entry
110101547         CDS       T05027                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
dct  Dendrobium catenatum
Pathway
dct00040  Pentose and glucuronate interconversions
dct00051  Fructose and mannose metabolism
dct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110101547
   00051 Fructose and mannose metabolism
    110101547
Enzymes [BR:dct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     110101547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Pyr_redox_2 Sacchrp_dh_NADP UDPG_MGDP_dh_N FAD_binding_2 ThiF 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 110101547
NCBI-ProteinID: XP_020685142
LinkDB All DBs
Position
Unknown
AA seq 358 aa AA seqDB search
MGEVGDGGEENMAAWLLGINNLKVLPYKLPPLGPNDVRVRMKAVGICGTDVHYLKTMRMT
HYVVKEPMVIGHECAGIIEELGSEVKSLAVGDRVAVEPGMTCGRCKYCKAGRYNLCDDTK
SLGLPPIHGSLANQLVHPADLCFKLPDNVNLEEGAMCEPLSVGVHACRRANINPETNVLI
VGAGTIGLVTMFTARAFGSPRIVIADVDEQRLLIAKSLGADEFVKVSPSIEDLDQEVEQI
KKAMGSDIDVTFDCAGFSKTMSTALNATRTGGKICLVGMGHNEMTIPLTSAVAAREVDII
GAFRYKETWPLCIELIRSGKIDVKPLITHRFGFSQEEVEEAFEVSARGGKAIKVMFNL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagtcggcgatgggggagaagagaacatggcagcatggcttctcggcattaac
aatctaaaggtcctgccttacaagctcccaccacttggccctaatgatgttcgcgtgcgc
atgaaagctgttggcatttgtggcactgatgtccattatctgaagactatgaggatgact
cattatgttgtgaaagagcctatggtgattggacatgaatgtgctggaattattgaagag
ttgggaagtgaagtgaaatctcttgctgtgggtgaccgtgtcgctgtagaaccaggaatg
acctgtgggcgctgcaagtattgcaaggctgggcgttacaacctatgtgatgacacaaag
tccttaggtcttccgccaattcatggttctcttgctaatcagctggtgcatcctgctgat
ctttgctttaagcttcctgacaatgtgaatttggaggaaggggctatgtgcgagcccctt
agtgttggggtacatgcttgcaggagagctaatattaatccagaaacaaatgtgcttatc
gttggggccggaactataggattagtcacaatgttcacagctcgtgcctttggatcccca
agaattgttatagccgatgttgatgaacaacgccttttgattgcaaaatctcttggggca
gatgaatttgtcaaggtttctccaagcattgaggacttagaccaggaagtggagcaaata
aaaaaagctatgggttctgatatcgatgtgaccttcgattgcgctggcttcagtaaaaca
atgtcgaccgcgctgaatgccactcgcaccggtggcaagatttgccttgtaggaatgggc
cacaatgagatgactattcctcttacttctgctgtagcagcaagagaagttgatattatt
ggtgcattccggtacaaagaaacttggcccctgtgcattgaactcataaggtctggaaaa
attgatgtgaagcctttgataactcaccggtttgggttttctcaggaggaggtcgaggaa
gcattcgaagttagcgctcgtggtggtaaagcaattaaggtcatgttcaacctctag

DBGET integrated database retrieval system