KEGG   Dendrobium catenatum: 110104891Help
Entry
110104891         CDS       T05027                                 

Definition
(RefSeq) probable alpha-glucosidase Os06g0675700
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dct  Dendrobium catenatum
Pathway
dct00052  Galactose metabolism
dct00500  Starch and sucrose metabolism
dct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110104891
   00500 Starch and sucrose metabolism
    110104891
Enzymes [BR:dct01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     110104891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110 DUF3672
Motif
Other DBs
NCBI-GeneID: 110104891
NCBI-ProteinID: XP_020689832
LinkDB All DBs
Position
Unknown
AA seq 877 aa AA seqDB search
MRSNIIPCFSLLFLLVVSLLPSSTLATLVQQDQSDGDGYGYRLISAHRNHKSSDLLTAEL
RLIRQSSYGFDIEKLRFIASFETKDRLRIRITDADQPRWEVPPEVIPRQTPPNEASRGAT
KSRVLSPAGSDLILTITNSIPFAFAVTRRSSGEVLFSTEGHSLVFKDRYLEISSSLPGEK
ANLYGLGEHTKSSFRLVPGEKLTLWNADIAAMNPNVNLYGSHPFYMDVRSPTGAAHGVLL
LNSNGMDVLYSGSLITYKVIGGVLDFYFFAGPTPVAVMDQYTKLIGRPAPMPYWSFGFHQ
CRYGYKNYSELVEVATGYEEAQIPLSVMWTDIDYMDGFKDFTLDPVNFPVEKMKNFVQRL
HENGQKYVVIVDPGISVNTTYATFQRGMKDEVFIKWNGTNYLGKVWPGPVYYPDFLNPAT
SEFWSKEISIFRKTLHFDGLWIDMNELSNFITSPPITDLDNPPYKINNGGVQRPIGSNTV
PASALHFGGQTEYNVHNLYGFLESKATHDALMRETGKRPFVLSRSTFVGSGKYTAHWSGD
NAATWEDLAYSIPSILNSGLFGIPMVGADICGFNGNTTEELCNRWIQLGALYPFARDHSD
KNSIRQELYLWKSVTESAKNVLGLRYRLLPYYYTLMYKAHQKGTPIARPLFFSFPEDPNT
YGISTQFLVGEALLVSPILKQGETSVEAYFPKGRWFSLFNLFHIVEATYGKRVTLQAPND
AINVHARGGNILILQERLDVTLEKERLFGILVVLDEEGTARGEVFLDDGEVVKMGGKKSE
WALIRFTCEAKDGKVKLKSQVVNGSYATETMLVNDIVFVGLRKSNSGVVTYDLKQKKSGS
KIFEGNANYNSHENFGFVQVNDISQPIGEAFELQLNM
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaggagcaatattattccttgtttctctctcctctttctcttggtagtctcattgctc
ccttcttccaccctcgccaccctcgtccaacaagaccagtccgacggcgacggctatggc
tacagactcatctcggcccacagaaaccacaaatccagcgatctcctcaccgccgaactc
cggctcatacgtcaatccagctatgggttcgacatcgagaaactacgcttcatagcaagc
tttgaaacgaaagaccggctgcgaatccgcatcaccgacgccgaccagccgagatgggaa
gtcccgccggaagtcatcccacgtcagacgcctccaaacgaagccagcagaggggcaacc
aagagccgcgtactctccccagctggctccgacctcatcttaacaatcaccaattccatc
cccttcgccttcgcagtcacccgccgctcctccggtgaggttctcttcagcaccgaagga
cacagcctcgtcttcaaagatcgctacttggagatctcgtcgtctctgcccggcgaaaaa
gccaatctttacggcctcggcgagcacaccaagtcctctttccgtcttgttcccggcgag
aagttaacgctttggaacgccgacatcgcggcaatgaatccaaatgtgaacctttatggg
tctcatcctttctacatggacgtgagatcgccgacgggagccgctcacggcgttctgttg
cttaacagcaatgggatggatgtgctttatagtgggagtcttattacttataaagtgatt
ggcggtgtcttggatttctacttcttcgccggaccgacgccggtggctgttatggatcag
tacacgaagctcatcggaaggccggccccgatgccttactggtcttttggatttcaccaa
tgtcgctatggctacaagaactactctgagctggtagaagtcgccaccggctacgaagag
gctcaaatccctctctccgtcatgtggaccgacattgattacatggatggattcaaagac
ttcaccctcgatcccgttaatttccccgttgaaaagatgaagaatttcgtccaacggctc
cacgagaatgggcagaagtacgtcgtcatcgtcgacccaggtatcagcgtgaacaccaca
tacgcgacattccagagaggaatgaaagatgaagtttttattaaatggaatggaactaac
tatctcggcaaagtatggcctgggccggtctactatcccgacttcctgaacccagccaca
tctgaattctggagcaaggagatctccatctttcgcaaaactttgcattttgatggtctc
tggatagacatgaacgaattgtcaaacttcattacttcccctccgatcacagatttggac
aaccctccttacaaaatcaacaacggtggcgtccagcgaccaataggtagcaacacagtg
ccggcctctgccttgcactttggaggccaaacggagtacaacgttcataacttgtatgga
tttctggaatctaaagcaacacatgatgcgttgatgagggagacggggaagaggcctttc
gtgctgtcgcgatcaacgtttgttggatcggggaagtatacggcgcattggagtggtgat
aatgctgcgacatgggaggatcttgcttactctattccttccattttgaactccggattg
tttggaataccgatggtaggagctgatatttgtggcttcaatggtaatacaacagaggag
ctttgcaatcggtggattcagttaggcgcgttatatccttttgcaagagaccattcagat
aagaactcaatcaggcaggagctttatctctggaagtctgtaactgaatctgcaaagaat
gttcttgggttgagatatcgtctcctcccttactactacacgctaatgtacaaagctcat
cagaagggtaccccaattgcaaggccattgttcttctccttccctgaagatcccaatact
tacggaatcagcacacaattcctagtcggagaagcactcttggtttcacccatcttaaaa
caaggagaaacctcagtggaagcttacttccccaaaggaaggtggttcagcctcttcaac
ctctttcatatagtagaagccacttatgggaaaagggtgacacttcaggccccaaatgat
gccattaatgttcatgcccgaggagggaacattctgatcctgcaggaaagactggatgtt
actttggagaaagagagattgtttgggatcttagtggtgcttgatgaagaaggaacagct
agaggagaagttttcttggatgatggtgaggtggtgaagatgggagggaagaagagtgag
tgggctctgattaggtttacatgcgaagctaaagatgggaaggtgaagctgaagtcccaa
gttgtgaatggcagttatgcaacagagacgatgttagtgaatgatatagtttttgttggg
ctgaggaagtcaaattccggtgttgttacatatgatctgaagcaaaagaaatcgggttcg
aagatctttgaaggtaatgcgaactataattcacatgaaaattttggtttcgtgcaagtc
aatgacatatcacaacctattggagaagcttttgagttgcaactcaatatgtga

DBGET integrated database retrieval system