KEGG   Dendrobium catenatum: 110105125Help
Entry
110105125         CDS       T05027                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
dct  Dendrobium catenatum
Pathway
dct00040  Pentose and glucuronate interconversions
dct00051  Fructose and mannose metabolism
dct01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110105125
   00051 Fructose and mannose metabolism
    110105125
Enzymes [BR:dct01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     110105125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C UDPG_MGDP_dh_N Pyr_redox_3 COG2
Motif
Other DBs
NCBI-GeneID: 110105125
NCBI-ProteinID: XP_020690157
LinkDB All DBs
Position
Unknown
AA seq 357 aa AA seqDB search
MGKGGDGGEENMAAWLVGINTLKIQPFKLPSVGPHQVRVRMKAVGICGSDVHYLKAMRCA
HFIVKEPMVIGHECAGVIEEVGSEVKSLVVGDRVALEPGISCGRCRHCKGGRYNLCVDMK
FFATPPVHGSLANQVVHPADLCFKLPEDVSLEEGAMCEPLSVGVHACRRANVGPETNVLI
MGAGPIGLVTMLAARAFGAPRIIIVDVDEYRLSVAKSLGADDFVKVSTNIQDLDDEVHQI
QKVMGSDIDTAFDCVGFSKTMSTALNSTRLGGKVCLIGMGHDQMTLPLTSASAREVDIVS
LFRYKDTWPLCIEFLRSGKIDVKPLITHRFGFSQKEVEEAFEVSARGGNAIKVMFNL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaggcggagatggaggagaggagaacatggcagcatggctggttggcattaac
actctaaagattcaacctttcaagctcccatcagtcggccctcatcaggttcgggttcga
atgaaggctgttggaatttgtggcagtgatgtccattatttaaaggcaatgaggtgtgct
cattttattgtcaaagaacccatggtgattggacatgagtgtgctggggttattgaagag
gtaggaagtgaagtgaagtctcttgttgtgggtgaccgagtggctttagaacctgggatc
agttgcggacgttgcaggcattgtaagggcgggcggtacaacctatgtgttgacatgaaa
ttctttgccaccccacctgttcatggttctcttgctaatcaggtggtgcatcctgctgat
ctgtgttttaaacttcctgaagatgtgagcttggaagaaggagccatgtgtgagcccctt
agtgttggggtacatgcttgcaggagagctaatgttggcccagagactaatgtgctcatc
atgggagctggacctataggattagtcacaatgcttgctgctcgtgccttcggagccccc
agaattattatagttgatgttgacgaataccgcctttcggtcgcaaaatctcttggtgcg
gatgactttgttaaggtttccacaaacattcaggatttggatgatgaggtccatcaaata
cagaaagttatgggatctgacattgatacggccttcgattgtgttggcttcagcaaaaca
atgtcgactgctctaaattctactcgtcttggtggcaaagtttgtcttattggtatgggc
cacgatcagatgactcttcctctcacttctgcatcagccagagaagttgacattgttagt
ttgtttcgctacaaggacacttggcccctctgtattgagttcctgagatcagggaagatt
gatgtgaaacctttgatcacgcatcggttcgggttctctcagaaggaggttgaagaagca
tttgaagtcagcgctcgaggcggcaatgcgatcaaagtcatgttcaacctgtag

DBGET integrated database retrieval system